KEGG   Aliivibrio fischeri ES114: VF_0054Help
Entry
VF_0054           CDS       T00236                                 

Gene name
gpp
Definition
(RefSeq) guanosine pentaphosphate phosphohydrolase
  KO
K01524  
exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VF_0054 (gpp)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     VF_0054 (gpp)
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     VF_0054 (gpp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
I:complement(61453..62946)
Genome map
AA seq 497 aa AA seqDB search
MKSSTMSPMYAAIDLGSNSFHMLVVRHINGSVQTMAKIKRKVRLAAGLNENNTLSHEAMQ
RGWDCLSLFAERLQDIPVENIRIVGTATLRVASNVDIFLEKANQILGHNINVIEGEEEAR
MIYQGVAHTSGGNGRRLVVDIGGASTELIIGEGFEAQALTSLKMGCVTWLEGYFKDRALT
QKNFNAAIAGAKETLAPILQQYTDLGWQTCVGASGTVQALQEIMLAQGMDEVITLAKLKR
LQKQAMQYEHLEELDIDGLTLERALVFPSGLSILIAIFELLNIDSMTLAGGALREGLCYG
MIDELQHDEVCQRTIKSTQQRYQLDVDYAQQVTDLSIQLVQQCGNDWLIEPQALPLLTAA
TQLHEIGMCIDYKKGGEHSAYLINALDLPGFTRAQKHLLGELLRRYREYFSAMPTQHAVS
DISAQRMLRILRLAIILTHRRDVNLAPTVTLSEKNDVLSLSIDGAWLAANPLTRSELEIE
ADKQTNIGWELVIDARD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttcaacaatgtcaccaatgtatgccgccatcgatttaggctccaatagcttc
catatgcttgttgtgcgtcatataaatggtagtgtgcaaaccatggctaaaattaaacgt
aaagttcgtttagctgcgggattaaatgaaaataacacactcagccatgaagctatgcaa
cgtgggtgggattgtttgagcttatttgcagaacgtctgcaagacatccctgtagaaaat
attcgcattgtcggtacagcaacgctgcgtgtcgctagcaatgtggatatcttcttagaa
aaagccaatcaaatcttaggtcacaacattaacgtgatcgaaggcgaagaagaagctcgt
atgatttaccaaggagttgcgcacacttcaggtggtaatggccgtcgtttagtcgttgat
atcggcggagcaagtacagagctaattattggtgaaggctttgaagcacaagcactcaca
agcttaaaaatgggttgtgtaacttggctagaaggctactttaaagatcgtgccctaacc
caaaagaactttaatgcagcaattgccggcgctaaagagacgttagctccaattttacag
caatatactgacctaggttggcagacctgtgttggagccagtggtacggtacaagcattg
caagaaattatgttggcgcaaggcatggatgaggtcatcaccttagccaagctaaagcgc
cttcaaaagcaagcaatgcaatatgaacacttagaagagttagatattgatgggttaaca
cttgagcgagcattagtgttcccaagcggtttatccatccttattgctatttttgaatta
ttgaacatcgattctatgactctagctggcggcgcgttacgtgaaggcctatgctacgga
atgatcgatgaactgcaacacgatgaagtgtgtcaacgcacaataaagagcacccaacaa
cgttatcaattagacgttgactacgctcaacaggtcactgacctctcaattcaacttgtg
cagcaatgtggtaacgactggcttattgagccacaagcattgccattgcttactgcggca
actcagcttcatgaaattggtatgtgtattgattataaaaaaggtggagagcactcagcc
tatttaattaacgcactggatttaccaggtttcactcgtgctcaaaaacacttacttggt
gagttattacgccgttaccgcgaatatttctcagccatgccaactcaacatgccgtttct
gatatctcggctcaacgcatgctacgtattttacgtttagcgattattctcactcatcgt
cgtgatgtgaatttagcacctactgtaacgctatcagaaaaaaatgatgttttgtcattg
tcgattgatggagcttggttggcggcaaatcctctaacgagatctgagttagagatcgag
gcggataaacagacgaatattggttgggagttggttatagatgctagggactag

DBGET integrated database retrieval system