KEGG   Vibrio fischeri ES114: VF_0065Help
Entry
VF_0065           CDS       T00236                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vfi  Vibrio fischeri ES114
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vfi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(72977..73738)
Genome map
AA seq 253 aa AA seqDB search
MTILVTRPEQESQALCDALNQSGHPAISHPLITIHPGNELSQLPRLFYSLNDGDFIIAVS
QHAVEHTQNYLKQLQLEWKQGVNYIAVGQKSAQHLKKYISDPVHYPTHSDSEHLLALPVL
QNATGKKAIILRGNGGRDLIYQVLNDLNVDVTYCEAYQRQAIAFDASIKTREWQEKNVNT
LIVTSGEQLSFFTSQFTSTDLNWVLKLRLLVPSERINQFAKELGYQHIETVGGASNSDLL
HYISEHHYDGIFK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttggtgactcgccctgagcaagagagccaagctttatgtgatgccttgaat
caatcagggcatccagctatttctcaccctcttatcaccatccaccccggcaatgaactg
tctcaactccctaggctattttattcacttaatgatggtgattttattatcgctgttagt
cagcacgctgttgagcacacgcaaaattatttaaaacagctacaattagagtggaaacag
ggggttaattatattgcggtcggtcaaaagagcgctcaacacctcaaaaagtatatttca
gatccagtacactacccaacccatagcgacagtgaacatttattagcccttcctgtctta
caaaacgcgacagggaaaaaagccattattcttcgaggaaatggcggacgggatctgatt
tatcaagttctgaacgatctcaatgtggacgtgacatattgcgaggcttaccaacgtcaa
gccatcgcatttgatgcatctatcaaaactcgagagtggcaagaaaagaacgtaaacaca
ttgattgtgaccagtggtgaacaactctcttttttcacctctcaatttacaagtacagat
ttaaattgggtactgaagcttagattattggtaccaagtgagcgcattaaccagtttgca
aaagaacttggttatcaacatattgaaacggttggcggagcctctaattccgacttgctg
cactatatcagtgagcatcattatgatgggattttcaaatga

DBGET integrated database retrieval system