KEGG   Aliivibrio fischeri ES114: VF_0106Help
Entry
VF_0106           CDS       T00236                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00230  Purine metabolism
vfi01100  Metabolic pathways
Module
vfi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VF_0106 (gmk)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VF_0106 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase ABC_tran AAA_18 MMR_HSR1 AAA_22 CPT cobW AAA_29
Motif
Other DBs
NCBI-GeneID: 3277846
NCBI-ProteinID: YP_203489
UniProt: Q5E8P5
Position
I:complement(124997..125620)
Genome map
AA seq 207 aa AA seqDB search
MSKGTLYIVSAPSGAGKSSLISALLESNPTYAMKVSVSHTTRGMRPGETDGVHYHFIQKE
HFEELIQKGEFLEYAEVFGNYYGTSRVWIEETLDKGIDVFLDIDWQGARQIREQMPLAKS
VFILPPSNGELERRLNARGQDSDAVIAKRMSEAKSEISHYDEYDYVIINDDFDTAQMDFR
SIIRAERLKQDKQTTKYKGMLEALLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggtacactttatattgtgtcagccccaagtggtgctggtaagtcgagtttg
atctcggcactgttagaaagcaacccaacttatgctatgaaagtctctgtgtctcatact
actcgtggtatgcgcccaggagaaactgatggtgttcattatcactttattcagaaagag
cattttgaagaactgattcaaaaaggtgaattcttagaatatgccgaagtgttcggtaac
tactatggaacatctcgagtatggatcgaagagacccttgataaaggtattgatgtgttc
ttagatattgattggcaaggtgctcgtcaaatccgtgaacaaatgcctttagcaaaaagc
gtattcattctacctccatcaaatggagaactagaacgacgcctaaatgcacgtggccaa
gacagcgatgctgttattgctaagcgcatgagcgaagcaaaatctgaaatttcacattac
gatgaatacgattatgtgatcattaatgacgattttgatactgcacaaatggacttccgt
tcaattatccgtgcagaacgcttaaaacaagacaaacaaacaacgaaatataaaggcatg
ttagaagcgctattagcggactaa

DBGET integrated database retrieval system