KEGG   Aliivibrio fischeri ES114: VF_0206Help
Entry
VF_0206           CDS       T00236                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VF_0206 (tpiA)
   01230 Biosynthesis of amino acids
    VF_0206 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_0206 (tpiA)
   00051 Fructose and mannose metabolism
    VF_0206 (tpiA)
   00562 Inositol phosphate metabolism
    VF_0206 (tpiA)
Enzymes [BR:vfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VF_0206 (tpiA)
Exosome [BR:vfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VF_0206 (tpiA)
  Exosomal proteins of bladder cancer cells
   VF_0206 (tpiA)
  Exosomal proteins of melanoma cells
   VF_0206 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(229534..230304)
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVELLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA
IILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLTPVLCIGESEAQNEAGETVAVCARQIDAVINTQGVDALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAEAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaactaaacggcagcaaagaaatggttgtt
gaactactaaacggtcttaacgctgaacttgaaggcgttacaggcgtagacgtagcagtt
gctccacctgcactatttgtagaccttgctgagcgtacgcttactgaagctggtagcgca
atcatcctaggtgctcaaaacactgatctaaacaacagcggtgcattcactggcgacatg
tctccagctatgcttaaagagttcggtgcaactcacatcatcatcggtcactctgagcgt
cgtgaataccacaacgaatcagacgagttcgttgctaagaaattcgctttcctaaaagaa
aacggtcttactcctgttctttgtatcggtgaatctgaagctcaaaacgaagctggtgaa
actgttgcagtatgtgcacgtcaaatcgacgcagttatcaacactcaaggcgttgatgct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagct
acagctgaagatgcacaacgcatccacgctcaaatccgtgctcacattgctgagaaatct
gaagaagttgctaagaacgttgttatccaatacggcggttctgttaagcctgaaaacgct
gcagcttacttcgcacaaccagacatcgatggtgctctagttggcggggcagctcttgat
gcgaaaagctttgcagctatcgctaaagcagcagctgaagcaaaagcttaa

DBGET integrated database retrieval system