KEGG   Aliivibrio fischeri ES114: VF_0206Help
Entry
VF_0206           CDS       T00236                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00010  Glycolysis / Gluconeogenesis
vfi00051  Fructose and mannose metabolism
vfi00562  Inositol phosphate metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
vfi01230  Biosynthesis of amino acids
Module
vfi_M00002  Glycolysis, core module involving three-carbon compounds
vfi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_0206 (tpiA)
   00051 Fructose and mannose metabolism
    VF_0206 (tpiA)
   00562 Inositol phosphate metabolism
    VF_0206 (tpiA)
Enzymes [BR:vfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VF_0206 (tpiA)
Exosome [BR:vfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VF_0206 (tpiA)
  Exosomal proteins of bladder cancer cells
   VF_0206 (tpiA)
  Exosomal proteins of melanoma cells
   VF_0206 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3277209
NCBI-ProteinID: YP_203589
UniProt: Q5E8E5
Position
I:complement(229534..230304)
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVELLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA
IILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLTPVLCIGESEAQNEAGETVAVCARQIDAVINTQGVDALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAEAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaactaaacggcagcaaagaaatggttgtt
gaactactaaacggtcttaacgctgaacttgaaggcgttacaggcgtagacgtagcagtt
gctccacctgcactatttgtagaccttgctgagcgtacgcttactgaagctggtagcgca
atcatcctaggtgctcaaaacactgatctaaacaacagcggtgcattcactggcgacatg
tctccagctatgcttaaagagttcggtgcaactcacatcatcatcggtcactctgagcgt
cgtgaataccacaacgaatcagacgagttcgttgctaagaaattcgctttcctaaaagaa
aacggtcttactcctgttctttgtatcggtgaatctgaagctcaaaacgaagctggtgaa
actgttgcagtatgtgcacgtcaaatcgacgcagttatcaacactcaaggcgttgatgct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagct
acagctgaagatgcacaacgcatccacgctcaaatccgtgctcacattgctgagaaatct
gaagaagttgctaagaacgttgttatccaatacggcggttctgttaagcctgaaaacgct
gcagcttacttcgcacaaccagacatcgatggtgctctagttggcggggcagctcttgat
gcgaaaagctttgcagctatcgctaaagcagcagctgaagcaaaagcttaa

DBGET integrated database retrieval system