KEGG   Vibrio fischeri ES114: VF_0284Help
Entry
VF_0284           CDS       T00236                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vfi  Vibrio fischeri ES114
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vfi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vfi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:288794..289261
Genome map
AA seq 155 aa AA seqDB search
MIAAMAKNRIIGIDNQMPWHLPADFAWFKKCTMGKPIVMGRKTYESIGRPLPGRLNIVLS
RDANLQIDGVTCVTSIEEAKQAAGDIEELMIIGGGSIYQACLSDADKLYLTFIDADINGD
TQFPDWGEGWNQTHSETYSKDEKNQYDMEFVVLER
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcaatggcaaagaatcgtattattggtattgataatcagatgccatggcat
ttacccgctgatttcgcttggtttaaaaaatgcactatgggtaaacctattgtcatgggg
cgtaagacttatgaatctattggtcgtccattaccgggccgattgaatatcgtattaagc
cgtgatgctaatttacaaatagacggagtgacttgtgttacttcgattgaagaagcgaaa
caagctgcaggtgatattgaagaacttatgattattggtggtggctcaatttaccaagcg
tgtctttctgatgcagataagttatacctgacttttattgatgctgacatcaatggcgat
actcaattccctgattggggtgagggttggaatcagactcattctgaaacgtattcgaaa
gatgaaaagaatcagtatgatatggagtttgtggttcttgagagataa

DBGET integrated database retrieval system