KEGG   Aliivibrio fischeri ES114: VF_0284Help
Entry
VF_0284           CDS       T00236                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VF_0284 (folA)
   00670 One carbon pool by folate
    VF_0284 (folA)
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VF_0284 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:288794..289261
Genome map
AA seq 155 aa AA seqDB search
MIAAMAKNRIIGIDNQMPWHLPADFAWFKKCTMGKPIVMGRKTYESIGRPLPGRLNIVLS
RDANLQIDGVTCVTSIEEAKQAAGDIEELMIIGGGSIYQACLSDADKLYLTFIDADINGD
TQFPDWGEGWNQTHSETYSKDEKNQYDMEFVVLER
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcaatggcaaagaatcgtattattggtattgataatcagatgccatggcat
ttacccgctgatttcgcttggtttaaaaaatgcactatgggtaaacctattgtcatgggg
cgtaagacttatgaatctattggtcgtccattaccgggccgattgaatatcgtattaagc
cgtgatgctaatttacaaatagacggagtgacttgtgttacttcgattgaagaagcgaaa
caagctgcaggtgatattgaagaacttatgattattggtggtggctcaatttaccaagcg
tgtctttctgatgcagataagttatacctgacttttattgatgctgacatcaatggcgat
actcaattccctgattggggtgagggttggaatcagactcattctgaaacgtattcgaaa
gatgaaaagaatcagtatgatatggagtttgtggttcttgagagataa

DBGET integrated database retrieval system