KEGG   Vibrio fischeri ES114: VF_0401Help
Entry
VF_0401           CDS       T00236                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vfi  Vibrio fischeri ES114
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vfi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vfi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:430383..431651
Genome map
AA seq 422 aa AA seqDB search
MYKFRIQGSDKPLSGEVTISGAKNAALPILFASLLAEEPVEVANVPKLRDVDTTMELLKR
LGAEVSRNGSVHIDASGVNDFCAPYDLVKTMRASIWALGPLVARFGKGQVSLPGGCAIGA
RPVDLHIHGLEQLGATIKLEEGYVKAEVDGRLKGAHIVMDKVSVGATITVMCAATLAEGT
TVLENAAREPEIVDTANFLNAIGAKVSGMGTDTITIEGVERLGGGYHEVVADRIETGTFL
VAAAVSGGKIVCKNTKAHLLEAVLAKLEEAGADVQTGDDWISLDMTGRELKAVNIRTAPH
PAFPTDMQAQFTLLNMMAKGSGIITETIFENRFMHIPELQRMGAHAEIEGNTAICGDTDG
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIARGYDKIEDKLTALGANIERVHSD
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtataagtttcgaattcaaggaagtgataaaccactttctggcgaagttacaatttct
ggtgcaaaaaatgctgcactaccaattctatttgcttcgttacttgcagaagaacctgtt
gaagtagcaaacgtaccgaaacttcgtgatgttgacaccacgatggaactgttaaagcgt
ttaggtgctgaagtatctcgtaacggttctgttcatattgatgcaagtggcgtaaatgac
ttctgcgcaccttatgatttagtgaaaacaatgcgtgcatcaatttgggcattaggtcca
ttggttgctcgttttggtaaaggtcaggtttcattacctggtggttgtgctatcggtgct
cgtcctgttgatcttcatattcacggattagagcaactaggtgcaacaatcaaacttgaa
gaaggttatgtaaaagcggaagttgatggtcgccttaaaggtgctcatatcgtaatggac
aaagtaagtgttggtgcaacaattactgttatgtgtgcagcaacattggctgaaggcacg
acggtattagaaaacgcagcacgtgaacctgaaattgttgatactgctaacttccttaat
gctatcggcgctaaagtgtctggtatgggtaccgatactattactatcgaaggtgttgaa
cgcctaggtggtggttatcacgaagtggttgctgaccgtattgagaccggtacgttcctt
gttgctgctgcagtatctggcggtaagattgtttgtaagaatactaaagcacatctactt
gaagcggtacttgctaagcttgaagaagcgggtgcagacgttcagactggtgatgattgg
attagcttagatatgactggccgtgagttaaaggcggtaaatatccgtactgcaccacac
ccagcattccctacagatatgcaagctcaattcacacttttaaatatgatggctaaaggt
tcaggtatcattactgaaacgattttcgaaaaccgtttcatgcacattcctgaactgcaa
cgtatgggtgctcacgctgaaatcgaaggtaatactgctatttgtggtgacactgatggt
ttaagtggtgctcaggttatggcgacagatttacgtgcatcagcaagccttgtgatcgca
ggttgtatagcaaaaggtgaaacaattgttgatcgaatttatcatatcgcccgtggatat
gataagattgaagataagttaaccgctttaggtgcaaatattgagcgagttcatagcgac
gacttataa

DBGET integrated database retrieval system