KEGG   Vibrio fischeri ES114: VF_0449Help
Entry
VF_0449           CDS       T00236                                 

Gene name
dsbC
Definition
protein disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vfi  Vibrio fischeri ES114
Brite
Enzymes [BR:vfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VF_0449 (dsbC)
Secretion system [BR:vfi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VF_0449 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:478401..479177
Genome map
AA seq 258 aa AA seqDB search
MSFIRRTSAMIIALMSVVSFTACSDEQAKNQDASPSAVEAAQPDAEQAITQRLTTLGLPV
EAIHDSEVDGFKQVETPFGIFYVSSDGKHFIQGRIFEFDENGDMKDLLAARFAKLVDSQS
ENMIVFPAKNEKHVITVFTDITCGYCTKLHKEMKDYNDAGITVRYLAYPRQGYQGSVADK
MAQIWCADDKQQAMEDAKSNRPINGSKPATAECKNIIKEQYLLGRKMGVNGTPAIVLPSG
DLVPGYKPARELLSDLEK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttattcgccgaactagtgcgatgatcattgctttaatgagcgtagtttctttt
actgcatgttcagatgaacaagcaaaaaaccaggatgcgtcaccttctgctgttgaggct
gctcaacctgatgcagaacaagctattactcagcgactaacgactttaggtttgcctgta
gaagctatccatgattctgaagtagatggttttaaacaagttgaaacaccgtttgggatt
ttttacgtatcttcagatggtaagcattttattcaaggtcgaatttttgagtttgatgaa
aatggtgacatgaaagatttattagctgctcgttttgctaaattggtggatagccaaagc
gaaaatatgattgtattcccagctaaaaacgaaaaacacgttattactgtatttacagat
attacttgtggttactgtacaaaactgcataaagagatgaaagactataatgatgcgggt
attaccgttcgttatttagcataccctcgccaaggctaccaaggatcagttgctgataaa
atggctcaaatttggtgtgctgatgataaacagcaagcaatggaagatgcaaaatcaaat
cgtccaattaatggttcaaaacctgcaactgcagagtgtaaaaacatcattaaagaacag
tatttattaggcagaaagatgggtgtaaatggaacaccagcaatcgttcttccaagtggt
gatcttgttcctggatacaaaccagcacgagagcttctatctgatttagaaaaataa

DBGET integrated database retrieval system