KEGG   Aliivibrio fischeri ES114: VF_0498Help
Entry
VF_0498           CDS       T00236                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VF_0498 (holD)
   00240 Pyrimidine metabolism
    VF_0498 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VF_0498 (holD)
   03430 Mismatch repair
    VF_0498 (holD)
   03440 Homologous recombination
    VF_0498 (holD)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VF_0498 (holD)
DNA replication proteins [BR:vfi03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VF_0498 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:535542..535943
Genome map
AA seq 133 aa AA seqDB search
MPQQALQFLNEMDISVWQVRQTSYFPALENTTLSLPETCQLLFVAPAIPTERDAFLFGKV
LASMKLSPEQALFLSSESLEYIGEHHLDWCWFSGVSTTELEGVKILTSPLLSEMHSNTQS
RRDLWRQICSYDN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgccccagcaagcgttacagtttttaaatgagatggatatttcggtttggcaagttcgt
caaacaagctatttcccggcattagaaaacacaacattatcgttacctgaaacttgtcag
ttattatttgtagctcctgctataccgacagagcgtgatgcttttctatttggaaaagtg
cttgctagcatgaagctgtcacctgagcaggcgttatttctttcttctgagtcattagaa
tatattggggagcatcatttagattggtgctggttctctggggtatctaccacagagcta
gaaggcgttaaaatattaacctctcctttattgtcagagatgcattctaatactcaatca
cgacgtgatttatggcgacaaatttgttcttatgacaattaa

DBGET integrated database retrieval system