KEGG   Vibrio fischeri ES114: VF_0498Help
Entry
VF_0498           CDS       T00236                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vfi  Vibrio fischeri ES114
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vfi00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vfi00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vfi03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vfi03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vfi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:535542..535943
Genome map
AA seq 133 aa AA seqDB search
MPQQALQFLNEMDISVWQVRQTSYFPALENTTLSLPETCQLLFVAPAIPTERDAFLFGKV
LASMKLSPEQALFLSSESLEYIGEHHLDWCWFSGVSTTELEGVKILTSPLLSEMHSNTQS
RRDLWRQICSYDN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgccccagcaagcgttacagtttttaaatgagatggatatttcggtttggcaagttcgt
caaacaagctatttcccggcattagaaaacacaacattatcgttacctgaaacttgtcag
ttattatttgtagctcctgctataccgacagagcgtgatgcttttctatttggaaaagtg
cttgctagcatgaagctgtcacctgagcaggcgttatttctttcttctgagtcattagaa
tatattggggagcatcatttagattggtgctggttctctggggtatctaccacagagcta
gaaggcgttaaaatattaacctctcctttattgtcagagatgcattctaatactcaatca
cgacgtgatttatggcgacaaatttgttcttatgacaattaa

DBGET integrated database retrieval system