KEGG   Aliivibrio fischeri ES114: VF_0505Help
Entry
VF_0505           CDS       T00236                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VF_0505 (deoA)
Enzymes [BR:vfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VF_0505 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:542171..543502
Genome map
AA seq 443 aa AA seqDB search
MYLPQEIIRKKRDNKELTAEEINFFIQGVAKETVSEGQIAAFAMAVYFNEMTMPERIALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIAGYNITPSNDVFGKVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNI
SLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTALLT
DMNQVLASTAGNALEVREAIRFLTGEYRNPRLYEVTMALCAEMLVIANLAKDEQDARAKL
QTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHLESAQIIKPVFADTTGFVQAMDTRDLG
MAVVGMGGGRRVASDTIDYAVGLSDMIRLGQTADNQQPLAMIHARNEEQWQQAANAVKAA
IVISEKQPEATPEVYRKIRPEDV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtatctaccacaagagattattcgcaaaaaacgtgacaataaagagctaacagcagaa
gaaattaacttctttattcaaggcgtagcaaaagaaaccgtttcagaaggccaaattgca
gcgtttgcaatggcggtatattttaatgaaatgacgatgcctgaacgtatcgcattgact
tgtgctatgcgtgattctggtatggttatcgattggagccacatgaactttgatggccca
attgttgataaacactcaacaggtggtgttggtgatgtaacttcattaatgcttggccct
atggttgcagcatgtggcggttatgtaccaatgatctctggtcgtggtttaggtcacact
ggtggtacgcttgataaattagaatcgattgcgggttataacattactccgagtaacgat
gtatttggaaaagtaactaaggaagcgggtgttgctattattggtcagactggagaccta
gcacctgcggataagcgtgtttatgcgactcgtgatgtaacggctacagtggataatatt
tcattaatcactgcgtctattttatctaagaaattagcggctggtttagattctcttgtt
atggacgtaaaagtaggttctggcgcatttatgccaacttacgaagcatcagaagagtta
gctaaatcaatcgtagcggtagcaaatggtgctggtactaaaacgacagcattgcttact
gatatgaaccaagtactagcttcaacagcaggtaacgcattagaagttcgtgaagcgatt
cgtttcttaactggtgagtaccgcaatcctcgtttatatgaagtaacaatggcactttgt
gctgaaatgctagtgattgctaacttagcaaaagatgagcaagacgctcgtgctaaatta
caaacagtattagataacggtaaagcagcagagtgttttggtaaaatggtctttggtctt
ggtggaccaagcgatattatcgaaaattacgataatcatttagaaagcgcacaaatcatt
aaacctgtttttgctgatacaacgggttttgttcaggcaatggatacacgtgatttaggc
atggctgttgtaggaatgggtggtggtcgccgtgttgctagcgatacgatcgattatgct
gtagggttaagcgatatgattcgtttaggtcaaactgcggataatcaacaaccacttgca
atgattcatgctcgtaatgaagagcaatggcaacaagctgccaatgcagtaaaagcagcg
attgtgattagtgagaaacaaccagaagcgactcctgaagtttaccgtaaaattcgccct
gaagatgtgtaa

DBGET integrated database retrieval system