KEGG   Aliivibrio fischeri ES114: VF_0583Help
Entry
VF_0583           CDS       T00236                                 

Gene name
recD
Definition
(RefSeq) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VF_0583 (recD)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VF_0583 (recD)
DNA repair and recombination proteins [BR:vfi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     VF_0583 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 AAA_22 UvrD-helicase DUF2075 UvrD_C AAA_16 AAA_28 T2SSE CbiA FtsK_SpoIIIE AAA_29 TrwB_AAD_bind PhoH DEAD NTPase_1 SRP54 AAA RNA_helicase ResIII NACHT DUF87
Motif
Other DBs
NCBI-GeneID: 3277335
NCBI-ProteinID: YP_203966
UniProt: Q5E7B8
Position
I:640434..642452
Genome map
AA seq 672 aa AA seqDB search
MLKQLQHLMDHGVLRPLDLQFAKFIAQQEKNSDSNLLMLLSAITSHELGRGHVCIDIEQI
EQGELFTLPAKYRDALLELVPERSAWAEQLINASTVSNGTEATPLAFDGTRLYLQRYWAF
EQRVSNRITKAAQSVAVNPQLSNTLDELFARQYHFLFSALKKLENNNQVSRQQLVCDMLD
VVQSDDLDWQAIDTVLLAATKSSELETLDQLIPNNHCVNWQKVAAAVALTRRFSVISGGP
GTGKTTTVTKLLASLVTQAKQDNKNIAIKLVAPTGKAAARLTESIGQAVQSIGLAPEVKE
AIPTDASTLHRLLGYIPNQVDFRHNKSNPLHLDVLVVDEASMVDLPMMARLLDAVPEHAR
VILLGDKDQLASVEAGAVLGDICQFTKMGYSQNQAQQLSQLTGFNLSAQLHNNAVADSLC
MLQKSYRFDARSGIGQLAKAINEGSKFKVEAVWDKGFSDIRFHDLSNNSYNAMITMMVNG
YRSYLGHIHAGDKPEIVLKAFSQIQLLCAMREGDFGVVGLNQRIEKALKKSDLIPHGDEI
WYSGRPVMVTQNDYGVGLYNGDIGIAMPDPIDQRLRVYFDMPDGSIRGVLPSQLPEHETV
YAMTIHKSQGSEFEHTVLALPAEFSPILTRELIYTGVTRAKKKLDLFATEKVVARGVMIK
TQRNSGLVSLMN
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcaattacaacacttaatggatcatggtgtacttcgcccattggatcttcaa
tttgctaaatttatcgctcagcaagaaaaaaacagtgatagtaatttacttatgttgcta
tcagccattacgagtcatgaactaggtcgtggtcatgtatgtattgatattgagcagata
gagcaaggggagctctttactcttccagcaaaatatcgtgatgcattattagagttagtc
cctgaaagaagcgcttgggcagaacaattaattaatgcatcaactgtctcaaatggcaca
gaggcaacccctttagcttttgatggtactcgcttgtatttacaacgctactgggcattt
gaacaacgtgtgtctaaccgtattactaaagcggcgcaaagtgttgcagtaaaccctcag
ctatcgaatacattggatgagttgtttgctcgtcagtatcattttctattttcagcattg
aaaaagttggagaataacaatcaagtttctcgccaacaattagtgtgcgatatgttggat
gttgttcaatctgatgatctggattggcaggcgattgatacggtgttattagctgcgacc
aaatcttcagaattagaaacgttagatcaattaattccaaataaccactgtgtgaattgg
caaaaagtcgcggcagctgtggcgttaactcgtcgattctcagtaatttctggtggtcca
ggtacgggtaaaacaaccacagtaaccaagcttttggcttccttagtgacacaagctaag
caggataataagaacatagcgattaaactggttgcgccaacaggtaaagccgcggcgcgt
ttgactgaatccattggtcaggcggtacaatccattggtttagcacctgaagtgaaagaa
gcgatcccaacagatgccagtacactacatcgcttacttggttatattcctaatcaagtg
gattttcgtcataacaaatccaatccgttacaccttgatgtattggtggtggatgaagcg
tctatggtcgatttgcctatgatggctcgattactcgatgccgtgcctgaacacgctcgt
gttattttattgggtgataaagatcaactcgcttcagttgaagcgggagcggtgttaggt
gatatttgtcagtttactaaaatgggttacagccagaatcaagcacagcaattatctcaa
ctaactggctttaatctatcggcacaattacataataatgcggttgcagatagcttatgt
atgctgcaaaagagttaccgttttgatgcgcgttcaggcataggtcagcttgccaaagca
attaatgaaggcagtaaatttaaagtagaagctgtgtgggataaagggttttcagatatt
cgttttcatgatttaagtaataatagctacaacgcaatgattactatgatggttaatggt
tatcgtagttacttagggcatatccatgcaggtgataaacctgaaatcgtactgaaagca
tttagccaaattcaattattatgtgcgatgcgcgaaggggattttggtgtggttggatta
aatcaacgtattgaaaaagcgttgaaaaagtctgatttaatccctcatggtgatgaaatt
tggtattcgggtcgtcctgttatggttacgcaaaatgattatggtgttggtttgtataat
ggcgatattggtattgctatgccagatcctattgatcagcgtttgcgtgtctattttgat
atgccagatggctctattcgtggtgtgctaccaagccaattaccagaacatgaaacggtt
tatgctatgaccattcataagtctcagggctctgagtttgagcatacagtattggcatta
ccagcagagtttagcccaattttaacccgtgagctgatttatacgggcgtgactcgagcg
aagaaaaaactcgatttatttgcgacggaaaaagtggtggctcgaggggttatgattaaa
actcagagaaacagtgggttagtatcactaatgaattaa

DBGET integrated database retrieval system