KEGG   Aliivibrio fischeri ES114: VF_0605Help
Entry
VF_0605           CDS       T00236                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_0605 (bglA)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VF_0605 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:664198..665607
Genome map
AA seq 469 aa AA seqDB search
MKFAHDFLFGAATASYQVEGAWDQDGKGPTNWDEFTKIPGKTFEGTNGDVAVDHYNRYKE
DIALMAEMGLESYRFSISWARIFPNGTGEINQKGIDFYNNLIDECLKYGIVPFVTLYHWD
LPLALEKEGAWLNKATGDAYVEFAKLCFNEFGDRVKHFITFNETVVFCALGYMAGAHPPG
IQNDPKKYFQATHNVFYAHAKAVIEYKKLNQFGEIGLSHVFSPAFGVDDSEESHFAAMHA
NQFSMNWFYDPILLGKYPEYVVKQLQEEGNLPDWTDEELQTIFEAAPLNDFMGLNYYQPQ
RVEKIQGDVEARTITRENSTGSPGNPSYDNVYRTVKMADKKYTKWDWEISPEGFVGGLEM
LKEHYGQIKLYITENGLGDEDPIIEGEVCDIPRINFIKEHLGAVKEAVRRGVHIKGYYAW
SAIDLLSWLNGYKKQYGFIYVDHQNGLARKKKASFHWFKDVIATRGEDI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcacatgattttttatttggcgcagcaaccgcttcttatcaagtggaaggc
gcgtgggatcaagatggtaaaggtcctacaaactgggatgagtttactaaaataccagga
aaaacgtttgaaggaactaacggtgatgtcgcggttgatcattacaatcgttataaagaa
gacatcgctttaatggcggaaatggggttagagtcataccgtttttcaatttcttgggct
cgtattttcccaaatggaacgggtgaaattaaccaaaaaggcatcgatttttataataat
ctgatcgatgaatgtttgaaatatggcattgttccttttgttaccctatatcactgggat
ctgccattagcactagaaaaagaaggtgcatggttaaataaagcaacgggcgatgcgtat
gtcgagttcgctaaattatgtttcaacgaattcggtgaccgtgttaagcattttataacg
tttaatgaaacggttgtgttctgtgctctaggatatatggcaggcgcacacccaccaggc
attcaaaatgacccgaaaaaatacttccaagcaacacataacgtattttacgctcatgct
aaagcagtgattgaatataaaaaattaaatcaatttggtgagattggtttgagtcatgta
tttagccctgcatttggggttgatgattctgaagagagtcactttgctgcaatgcatgcg
aatcaatttagtatgaactggttctatgatcctattttgcttggtaaatacccagagtat
gtagttaagcaattacaagaagaaggtaaccttcctgattggacggatgaagagctacaa
actatttttgaagccgcacctttgaatgactttatgggattgaattattaccagcctcag
cgtgtagagaaaattcaaggggatgttgaagctcgtacgattacacgagaaaactcaacg
ggctcacctggtaaccctagttacgataatgtgtaccgtactgtgaaaatggcagataaa
aagtacacgaaatgggattgggaaatttcacctgaagggtttgttggcggattagaaatg
ctgaaagagcactatggtcaaattaaactctacatcacggaaaatggtttaggtgatgaa
gatccaatcattgaaggtgaagtgtgcgatattccacgtattaattttattaaagagcac
ttaggtgcggtaaaagaagcggttcgtcgtggtgttcatattaaagggtattacgcttgg
tctgccattgacttattaagttggttaaatggttataaaaagcaatatggttttatctat
gtagatcatcaaaatggattggctcgtaagaaaaaagcatcattccactggtttaaagat
gtcatagccactcgtggtgaagatatttaa

DBGET integrated database retrieval system