KEGG   Aliivibrio fischeri ES114: VF_0655Help
Entry
VF_0655           CDS       T00236                                 

Gene name
chiA
Definition
endochitinase (EC:3.2.1.14)
Orthology
K01183  
chitinase [EC:3.2.1.14]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VF_0655 (chiA)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     VF_0655 (chiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(718381..720921)
Genome map
AA seq 846 aa AA seqDB search
MKGIFIKSAIASALFISYGANAFDCSSTPIWQSTQAYSGGDTVQQNNIAYQAQWWSQGND
PETHSGEWQEWKNLGKCSTGGENIAPTVTIISPINNAIIPEASLITLQASADDKDGSITQ
VEFLSNNQSIAIVTSPPYNTPWIAIKNTTSIIVIATDDEGATTTESVSIKVQSAGELVPP
TIELTSPIGNEKLTTGDTLVVSANANDSDGVINNVEFYIDNQLAFTDTEAPFEYSWLATS
GPHQFKAKATDNDNQTTISKGVTLEVSEPSSGGCAGLPQYKSGTNYAAGDEVQNLNQKYR
CDIGGWCSSSSDWAYAPGTGSNWQDAWTGLGVCSTPPQVTITSPNDNSVILAGSIVEVNA
SASDSDGSVIGVEFFANNVTLGSDTQAPYTVNWDATVIGSNTLKAVATDNEGNNSENSIL
VTVSDQNVVTALTSPITGSSLVLGKITQLKATATSLSSSITKVDFLVNGVIIASDTTSPY
SVNWTPAAIGAYTLSVEATDAQGNTALSTASSVSVVEQTLAKHKLIGYWHNFVNGSGCPI
RLADMSDEWDIIDIAFADNDRNSNGTVHFNLYSGDIHSSCPALDPTQFKQDMAALQAKGK
VFVLSLGGAEGTITLNTDNDEVNFVNSLTAIIDEWGFDGLDIDLESGSNLLHGTQIQARL
PTALKQIEANMGGDMYLTMAPEHPYVQGGMIAYSGIWGAYIPVINQVRDTLDLLHVQLYN
NGGLPNPYMPGSAPEGSVDMMVASVKMLVEGFELADGTFFAPLRDDQVAIGLPSGPSSAN
SGQAPIQNIVDALDCVTYGTACSSVVPSKLYSNFGGVMTWSINWDLHDGFNFSKPVGDKL
NQMNNQ
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggatattcattaagagtgctattgcttctgctctctttatctcatatggagca
aatgcatttgattgtagctcgacgccaatttggcaaagtactcaagcttatagtgggggg
gatactgttcaacaaaacaatattgcttaccaagcccaatggtggtcacaaggaaacgat
ccagaaacacattccggtgaatggcaagaatggaagaatcttggtaaatgtagtacagga
ggtgagaatatcgcaccaacagtgacaatcatatccccaataaataatgccataatccct
gaagctagcctgataacacttcaagcgagtgctgatgataaagacggttccattactcaa
gtagaattcttatcaaacaatcaatctattgccattgttaccagccctccttataacaca
ccttggattgctattaaaaacaccacatcaattattgttattgccacagacgatgaaggt
gccaccaccacagaatctgtttctataaaggttcaatcagcaggtgaacttgtccctcca
acaattgaacttacctctccaataggaaatgaaaaactaacaacaggcgacacattagtc
gtttcagccaatgcaaatgacagtgatggcgtaattaataatgtcgagttctacattgat
aatcaacttgcttttactgataccgaagcaccttttgagtattcatggttagcgacaagc
ggtcctcaccaatttaaagcaaaggcgacagataatgataatcagacaaccataagtaaa
ggcgttacacttgaggtatctgaaccatccagtggtgggtgtgcaggcctccctcaatac
aagtctggaacaaactatgcggctggtgatgaagttcaaaacttaaatcaaaaatatcgt
tgtgatattggtggttggtgctcatcatcatcagactgggcttacgctcctggaacggga
tctaattggcaagatgcatggacaggattaggcgtttgcagtacaccgccacaagtaacg
attacctcaccaaatgataatagtgtaattcttgctggttctatcgtcgaagtgaatgcg
agtgcaagtgatagtgatggaagtgttattggtgttgagttctttgcaaacaatgtcact
cttggatctgatacacaagcaccatataccgttaattgggatgctacagtaattggaagt
aatacattaaaagcagtagcaacagataatgaaggtaataacagtgaaaatagtattttg
gttacggttagtgatcaaaatgtggttacagcactcacctccccaataacaggttcgagt
ttagttctgggtaaaataactcaactcaaagcgacagcaacatctctaagcagttctatc
accaaagtagacttcttagttaatggcgttattatcgcctcagatacaacatcaccgtat
agtgtcaattggacaccagcagcaattggagcttacaccttatcggtcgaagctacagat
gcgcaaggtaatacagcattatctactgcttcaagtgtctctgttgtagaacaaacacta
gcgaaacataaacttatcggttattggcacaattttgtaaatggttcaggatgtccaatt
cgcttagctgatatgtcagatgaatgggatattattgatatcgcttttgctgacaatgac
agaaacagtaatggtaccgtgcattttaatctgtactcaggagatattcatagcagttgt
ccagcattagatccaactcaatttaaacaggatatggcagcactacaagcaaaaggcaaa
gtatttgttctttcacttggcggtgcagaaggaaccattacattaaatactgataatgat
gaggttaactttgtaaatagtctaacggctatcattgatgaatggggatttgatggactc
gatattgatttagaaagtgggtcaaatctacttcatggtactcaaatacaagctcgatta
cctacagcacttaaacaaatagaggctaatatgggtggcgatatgtatttaaccatggcg
ccagaacatccttatgtgcaaggtggaatgatcgcttacagtggtatttggggtgcctat
ataccggtgattaatcaagttcgagatacattagatttattacacgttcaactttataac
aatggcgggctaccaaatccatacatgcctggttcagcacctgaaggttctgtcgacatg
atggtagcgtcagtaaaaatgctagttgagggttttgaattagcagatggtaccttcttc
gctccattaagggatgatcaagttgcgattggattaccatcaggcccaagctctgcaaac
tcaggtcaagctccaattcaaaacattgtcgatgcactagactgtgttacttatggcacc
gcatgcagttcagtggttccaagtaaactctactcaaactttggtggagtaatgacatgg
tcaatcaattgggatttacatgatggatttaatttttccaaacccgttggtgataaatta
aatcaaatgaataatcaataa

DBGET integrated database retrieval system