KEGG   Aliivibrio fischeri ES114: VF_0820Help
Entry
VF_0820           CDS       T00236                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase, membrane subunit, binds cytochrome b556
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00020  Citrate cycle (TCA cycle)
vfi00190  Oxidative phosphorylation
vfi00650  Butanoate metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
Module
vfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vfi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VF_0820 (sdhD)
   00650 Butanoate metabolism
    VF_0820 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    VF_0820 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 3278386
NCBI-ProteinID: YP_204203
UniProt: Q5E6N1
Position
I:899078..899425
Genome map
AA seq 115 aa AA seqDB search
MVANVSSFGRNGVHDFILIRASAIILTLYTLYIVGFCAFGPELTYLSWTNFFGGLFTKAF
TMLALLSILIHAWIGLWQVLTDYIKPVMLRALLQLGLVSVLFVYFFSGLIIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtagctaatgtttcgtcatttggtcgtaacggtgtacacgattttattctgattcgt
gccagtgcgatcattcttactctatacacattatacattgttggcttttgtgcctttggg
ccagagttaacgtatttgtcatggactaacttctttggtggactatttacaaaagcgttt
accatgttagcgctattgtccattctaattcatgcatggattggtttatggcaagtgctt
actgattatatcaaaccagttatgttgcgtgctctgcttcagcttgggttggtatctgtt
ctgtttgtctatttcttctctggtttaattatagtgtggggtgtgtag

DBGET integrated database retrieval system