KEGG   Aliivibrio fischeri ES114: VF_0918Help
Entry
VF_0918           CDS       T00236                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA dehydrogenase/iron-dependent alcohol dehydrogenase/pyruvate-formate lyase deactivase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VF_0918 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_0918 (adhE)
   00620 Pyruvate metabolism
    VF_0918 (adhE)
   00650 Butanoate metabolism
    VF_0918 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    VF_0918 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    VF_0918 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VF_0918 (adhE)
   00626 Naphthalene degradation
    VF_0918 (adhE)
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VF_0918 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VF_0918 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1012473..1014974
Genome map
AA seq 833 aa AA seqDB search
MGIVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTS
TAIFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELS
NALMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDDTADVKRAVASVLMSK
TFDNGVVCASEQAVIVMDEVYDEVKERFASHKGYVLSKAEADKVRKVLLIDGNLNANIVG
QPATAIAEMAGVKVPADTKILVGEGIGEVSYDDEFAHEKLSPTLGMFRASSFENAVDQAV
KMVEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSL
TLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAMSDLEGK
KRAFLVTDRFLFNNGYADDVVQLLKAQGIEVQTFFDVEADPTLSVVEKGAEAMKSFQPDV
ILALGGGSPMDAAKIMWVMYEHPETHFAELAMRFMDIRKRIYKFPKMGKKAELVCITTTS
GTGSEVTPFAVVTDDKTGAKYPLADYEITPNMAIVDANLVMNMPKSLTAFGGYDAVTHAL
EAYVSVLANEYSDGQALQALKMLKEYLPSSYKNGANDPIAREKVHNAATIAGIAFANAFL
GVCHSMAHKIGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVA
DHLGLSQAGDRTAQKIERLLTWLEELKKDLDIPLSIKDAGVNEADFIAKLDELSVEAFDD
QCTGANPRYPLITELKEVLTTSYYGKPFVEGETFEGTTVIKKTEEPKAKKAKK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgttgaagataaggttatcaaaaaccacttcgcatcagagttcatctacaac
aaatataaagatgaaaaaacatgtggcattcttgaagaagacgataacctaggaacaatg
actatcgcagaacctgtaggtattatctgtggtatcgttccaacaactaacccaacatct
actgcaatcttcaaatctctaatctctctaaaaactcgtaacggtatcattttctcgcca
cacccacgtgcgaaaaactctactaatgatgcagcgaaacttgttttagacgcagcagtt
gcagctggtgctccaaaagacatcatcggttggattgatcaaccatctgtagaactttct
aatgcactaatgaagcacgacggtatcgctcttatccttgctactggtggtccaggcatg
gttaaagcagcatactcttcaggtaaacctgcaatcggtgttggtgctggtaacgttcct
gttgttatcgatgacacagctgatgttaaacgtgcagtcgcttctgttcttatgtctaaa
acattcgataacggcgtagtttgtgcttctgagcaagctgtaatcgtaatggatgaagta
tacgacgaagttaaagagcgttttgcttctcacaaaggttacgtactatctaaagctgaa
gcagataaagttcgtaaagttctacttatcgacggtaacctaaacgcaaacatcgtaggt
caacctgcaacagctatcgctgaaatggctggcgttaaagttccagctgatactaagatc
cttgttggtgaaggtatcggtgaagtatcttacgatgacgaattcgctcatgagaaacta
tctccaacactaggtatgttccgtgcgtcttctttcgagaacgcggtagaccaagctgtt
aaaatggtagaaattggcggtatcggccacacatctggtctgtacactaaccaagatgtt
aacgctgaccgtatccgttactttggtgacaaactaaaaacagcacgtattcttgtaaac
atcccaactactcacggtggtatcggtgacctttacaactttaacgttgcaccttctcta
actcttggttgtggttcatggggtggtaactctatctctgagaacgtgggtcctaagcac
cttatcaacaagaaaactgtagcgaagcgagctgaaaatatgttatggcacaaactacct
aagtctatctacttccgtcgtggcagccttccaatcgcaatgagcgacctagaaggtaag
aaacgtgcattccttgtaactgaccgtttcctattcaacaacggttacgctgatgacgta
gttcaactacttaaagctcaaggtatcgaagttcaaacattctttgatgtagaagcggat
ccaacactatctgttgttgagaaaggcgctgaagcaatgaagagcttccaacctgacgta
atccttgctctaggtggtggttcaccaatggatgctgctaagattatgtgggtaatgtac
gagcacccagaaactcatttcgcagaactagcaatgcgctttatggatatccgtaaacgt
atctacaagttccctaaaatgggtaaaaaagctgagcttgtatgtatcactacaacttca
ggtactggttcagaagttactccattcgctgttgttacagacgacaagactggtgctaaa
tacccactagctgattacgaaattacgccaaacatggcaatcgttgatgctaacctagta
atgaacatgcctaagtctctaaccgcatttggtggttacgatgcagtaactcacgcatta
gaagcttacgtatctgttcttgctaatgaatactctgacggtcaagcgcttcaagctctt
aagatgcttaaagaatacttaccatcaagctacaaaaatggtgcgaacgacccaatcgct
cgtgagaaagtacacaatgctgcaactatcgctggtatcgcgtttgctaacgcattccta
ggtgtgtgtcactcaatggctcacaaaatcggtgctgagttccacttaccacacggttta
gctaacgcattacttatctctaacgttgtacgttacaatgcgaacgataacccaactaaa
caaacagcattctctcagtacgaccgtccacaagcacgtcgtcgttacgcagaagttgct
gaccacctaggcctaagccaagctggtgaccgtactgctcagaagattgagcgtctacta
acttggttagaagagcttaagaaagatttagatattccactatctatcaaagatgcaggt
gttaacgaagcagacttcatcgctaaactagatgaactatctgttgaagcgttcgatgac
caatgtactggtgcgaacccacgttaccctctaatcacagagctaaaagaagtactaaca
acttcttactacggtaaaccttttgttgaaggtgaaacgtttgaaggcacaacagtaatt
aaaaaaactgaagagccaaaagcgaaaaaagcaaagaaataa

DBGET integrated database retrieval system