KEGG   Aliivibrio fischeri ES114: VF_1013Help
Entry
VF_1013           CDS       T00236                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00340  Histidine metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01230  Biosynthesis of amino acids
Module
vfi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    VF_1013 (hisD)
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VF_1013 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PAP_fibrillin
Motif
Other DBs
NCBI-GeneID: 3277807
NCBI-ProteinID: YP_204396
UniProt: Q5E638
Position
I:1119755..1121074
Genome map
AA seq 439 aa AA seqDB search
MKTLVWQSLSDSQQDTVLQRPAITEGANITAAVTSVINTVKQEGDAGVFALTEKFDGVKP
DSIRVSNAEIEAASDRLSEEMKTALKQAYSNISKFHQAQKPQPVKVETQPGVICEQITMP
INKVGLYIPGGSAPLPSTVLMLGIPAQIAGCHKVVLCSPPPIADEILYVAKLCKIDEVYN
IGGAQAVAAMAYGTESVSKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DESADPDFIAADLLSQAEHGPDSQVVLVTPSPIIADQVADAVERQLKELSREDIARQALG
SSLLIVADSLTQCVSISNFYGPEHLIVQTKNPRELLPLLDNAGSIFLGDYSPESAGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTVQELTADGLKGLAPTVVTMAEAEGLDAHKRAV
TIRIEKLAQLDVNKQEVNQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttagtttggcaatcattgagcgattcgcagcaagatacggttctacaacgt
cctgcgattacggaaggtgcgaatattaccgcagcagtaactagtgttattaataccgta
aaacaagagggtgatgctggtgtattcgcattaactgaaaagtttgatggcgtgaaacct
gactctattcgagtatcgaatgctgagattgaagcggcaagtgatcgtttgtctgaagaa
atgaaaacagcacttaaacaagcttatagcaatatttctaaatttcaccaagcacagaaa
ccacagcctgtaaaagttgaaacacagccaggtgtcatctgtgaacaaattactatgcct
ataaataaagtaggtttgtatattccaggtggtagtgcgccattgccatcaacagtccta
atgttaggtattcctgctcaaattgcaggttgtcataaagttgtattatgttcgccacct
ccaatagctgatgagattttgtacgtggcaaaactgtgtaagattgatgaagtatataac
attggtggggctcaagccgttgctgcgatggcgtatggaacagaatctgtctctaaagta
gataagatctttgggccaggtaatgcctatgtaactgaagcaaaacgtcaagtttcgaat
gatttccgtggtgcggcgattgatatgcctgcagggccatctgaagttttagtgattgct
gatgagagcgcagatccagactttattgcagcggatcttcttagccaagcagagcatggt
cctgattcacaagtagtattagttactccatcgccaattattgccgatcaagtcgctgat
gctgttgaaagacaattaaaagaacttagtcgtgaagatatagctcgccaagctttaggt
tcaagtttattgattgttgcagattcacttactcagtgtgtttcaatttcaaacttttat
gggcctgaacaccttattgttcaaactaagaatccgcgagagttactccctcttctagat
aatgcgggttcaattttcttaggtgattattcacccgaatcggcaggggattatgcatca
ggaactaatcacgtattgccgacttatgggtacacacgaacttattcaagtttaggatta
gcagatttctctaaacgaatgactgtgcaagagttaacggctgatggtttaaaaggtttg
gctccaacggttgtcacaatggctgaagcggaagggcttgatgctcataaaagagccgta
acgattcgaattgaaaagctcgctcagttagacgttaataaacaagaagtgaatcagtag

DBGET integrated database retrieval system