KEGG   Aliivibrio fischeri ES114: VF_1028Help
Entry
VF_1028           CDS       T00236                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VF_1028 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VF_1028 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VF_1028 (trpB)
Enzymes [BR:vfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VF_1028 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1132491..1133681)
Genome map
AA seq 396 aa AA seqDB search
MAKLDAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEFMTLLQEYAGRPTALTL
CRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKDEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKMQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVKLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDEHGQIEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYGAVTDDEALDAFKILARNEGIIPALESSHALAYALQL
AQAEPEKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgcctacttcggcgaatacggtggtcaatacgttccacagatttta
gttccagctttagagcaactagaacaagcctttattgatgcacaagaagatccagacttt
cgttctgagttcatgacgcttttacaagaatatgcgggtcgtccaactgcattgacgtta
tgccgcaatttaaccaaaggcacaaaaacaaagctataccttaaacgggaagatcttctt
catggtggtgcacataaaaccaaccaagtacttggccaagcactacttgcaaagcgtatg
ggcaaagatgagatcattgctgaaacaggtgcaggccaacacggtgttgccacagcacta
gcttgtgcactacttgggttaaaatgccgagtttatatgggagctaaagacgtagaacgt
caaagcccaaatgtattccgtatgaaactaatgggtgcagaagtcattcctgttcattca
ggctctgcgacgctaaaagatgcatgtaatgaagcactacgtgactggtctgcaacctat
gaaactgcacactatttattaggaacagcggcaggccctcatccattcccaaccatcgtt
cgtgagttccaacgtatgattggtgaagaaacgaaaatgcaaatcttagcgcgtgaaggt
cgtttacctgatgcggttattgcttgcgtgggtggcggttcaaatgctatcggtatgttt
gcagatttcattgaagaagaaagcgtaaaactaattggtgttgagcctgcaggtaaaggt
attgataccgaccaacacggcgcaccacttaagcatggtaaaacaggcattttctttgga
atgaaagccccattaatgcaagatgaacacggacagattgaagaatcatactcagtttct
gcaggtttagacttcccatccgttggtccacaacacgcccacctaaatgctattggtcgt
gctgaatacggtgcagtaacagatgacgaagcattagatgcattcaaaattcttgcaaga
aatgaaggtattattccagcattagaatcttctcatgctttagcatatgcattacaactt
gcacaagcagaaccggagaaagaacaactattggtagtaaacttatctggccgaggcgat
aaagacatcttcacagtacatgacattttaaaagaaaagggagaaatctaa

DBGET integrated database retrieval system