KEGG   Aliivibrio fischeri ES114: VF_1028Help
Entry
VF_1028           CDS       T00236                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00260  Glycine, serine and threonine metabolism
vfi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01130  Biosynthesis of antibiotics
vfi01230  Biosynthesis of amino acids
Module
vfi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VF_1028 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VF_1028 (trpB)
Enzymes [BR:vfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VF_1028 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3277531
NCBI-ProteinID: YP_204411
UniProt: Q5E623
Position
I:complement(1132491..1133681)
Genome map
AA seq 396 aa AA seqDB search
MAKLDAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEFMTLLQEYAGRPTALTL
CRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKDEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKMQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVKLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDEHGQIEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYGAVTDDEALDAFKILARNEGIIPALESSHALAYALQL
AQAEPEKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgcctacttcggcgaatacggtggtcaatacgttccacagatttta
gttccagctttagagcaactagaacaagcctttattgatgcacaagaagatccagacttt
cgttctgagttcatgacgcttttacaagaatatgcgggtcgtccaactgcattgacgtta
tgccgcaatttaaccaaaggcacaaaaacaaagctataccttaaacgggaagatcttctt
catggtggtgcacataaaaccaaccaagtacttggccaagcactacttgcaaagcgtatg
ggcaaagatgagatcattgctgaaacaggtgcaggccaacacggtgttgccacagcacta
gcttgtgcactacttgggttaaaatgccgagtttatatgggagctaaagacgtagaacgt
caaagcccaaatgtattccgtatgaaactaatgggtgcagaagtcattcctgttcattca
ggctctgcgacgctaaaagatgcatgtaatgaagcactacgtgactggtctgcaacctat
gaaactgcacactatttattaggaacagcggcaggccctcatccattcccaaccatcgtt
cgtgagttccaacgtatgattggtgaagaaacgaaaatgcaaatcttagcgcgtgaaggt
cgtttacctgatgcggttattgcttgcgtgggtggcggttcaaatgctatcggtatgttt
gcagatttcattgaagaagaaagcgtaaaactaattggtgttgagcctgcaggtaaaggt
attgataccgaccaacacggcgcaccacttaagcatggtaaaacaggcattttctttgga
atgaaagccccattaatgcaagatgaacacggacagattgaagaatcatactcagtttct
gcaggtttagacttcccatccgttggtccacaacacgcccacctaaatgctattggtcgt
gctgaatacggtgcagtaacagatgacgaagcattagatgcattcaaaattcttgcaaga
aatgaaggtattattccagcattagaatcttctcatgctttagcatatgcattacaactt
gcacaagcagaaccggagaaagaacaactattggtagtaaacttatctggccgaggcgat
aaagacatcttcacagtacatgacattttaaaagaaaagggagaaatctaa

DBGET integrated database retrieval system