KEGG   Aliivibrio fischeri ES114: VF_1458Help
Entry
VF_1458           CDS       T00236                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VF_1458
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VF_1458
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VF_1458
Enzymes [BR:vfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VF_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1614411..1615541
Genome map
AA seq 376 aa AA seqDB search
MKYLCMACNKEYAPKPELIKCECGSALWVKPQTSFSKKDLIENEFTPRRYSSAFPVKKDD
INITFNEAITPLCQAEISGTPILVKLDSLQPTGSFKDRGASLVINYLNNHGITSIAEDSS
GNGGSAYAGYAAKGNMQCNIFVPAGTSKGKTTQTRLYGANCIEVEGTREDVALAAIESSV
THGSHYVGHNWHPLFIEGVKSIAYEIWEQCGYKAPDNFVVPAGNGSLLAGAYIGFSELLK
GGEISKLPRLFGIQSESIQPFVQTFNNKEINITSEDTIAEGIKIKRSSRMNEIVQFVKET
NGNFISVNEQQIQSALKEMGAQGYFIEPTSATAFAGIAQLIKTQEIKPDELTVGVVTGNG
LKATNSIEHLINDMRG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacctctgtatggcgtgtaataaagaatacgcaccgaaacctgaactcattaaa
tgtgaatgtggctccgccctatgggttaaacctcaaacgtcatttagtaaaaaagatctc
atagaaaatgaattcacacctagacgctattctagtgctttcccagtaaaaaaagacgat
atcaatatcactttcaatgaagccatcacacctctttgccaagctgaaatatcaggaact
ccaatactggttaaactcgattcgctacaaccaacaggctcatttaaagaccgaggtgcc
tctcttgtaatcaattaccttaacaaccatggaataacaagcattgcagaagactcaagc
ggtaatggaggaagtgcttatgccggttatgccgctaaaggaaacatgcaatgcaacata
tttgtgcctgctggaacatccaaaggaaagacaacacaaacccgattatacggcgctaac
tgtattgaagtagaaggaacaagagaagatgttgctctagctgcaatagagagcagcgtc
actcatggaagtcattatgttgggcataactggcatcccctatttatcgaaggcgtcaaa
tccatcgcttatgaaatatgggaacagtgtggatataaagcccctgataattttgttgtt
cccgcaggaaatggaagtttactcgctggagcatatatcggtttctctgaattattaaaa
ggcggagaaataagcaaactccctcgcctttttggtattcaaagtgaaagcattcagccg
tttgtacaaacctttaacaataaagaaatcaacattacttcagaagataccattgctgag
ggtattaagattaagcgttcatcacgaatgaatgagatcgttcaatttgtaaaagaaacg
aatgggaattttattagtgttaatgaacaacaaatccaatcagcattaaaagagatggga
gcacaaggatactttatcgaaccaacatcagcgacggcatttgcaggaatcgctcagctt
ataaaaacgcaagaaatcaaacctgacgagcttaccgttggagtcgtaaccggaaatgga
ctcaaagcaacaaactcaattgaacatttaatcaatgatatgagaggttaa

DBGET integrated database retrieval system