KEGG   Aliivibrio fischeri ES114: VF_1556Help
Entry
VF_1556           CDS       T00236                                 

Gene name
pldA
Definition
(RefSeq) outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00564  Glycerophospholipid metabolism
vfi00565  Ether lipid metabolism
vfi00592  alpha-Linolenic acid metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VF_1556 (pldA)
   00565 Ether lipid metabolism
    VF_1556 (pldA)
   00590 Arachidonic acid metabolism
    VF_1556 (pldA)
   00591 Linoleic acid metabolism
    VF_1556 (pldA)
   00592 alpha-Linolenic acid metabolism
    VF_1556 (pldA)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VF_1556 (pldA)
    3.1.1.32  phospholipase A1
     VF_1556 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-GeneID: 3278841
NCBI-ProteinID: YP_204939
UniProt: Q5E4J5
Position
I:complement(1740086..1740859)
Genome map
AA seq 257 aa AA seqDB search
MKKWMLLIALAIPSLSFAKELNRIHAYEDSYILGSYISDLNKQTYIDGGFEDADGLHDVE
VKFKFSFAVPLFPVSQSSSIMFAYTQKSLWQLGNSDISSPFRETNYKPQFFLMHQSNMLI
FNNAEFGYMHESNGQTASLSRSWDRIYGALERIDGPVQYGVRAWYVIADEENNEDITDYL
GNYDVWASVGNDIGTLSTRFHYNFETDKGGAELGYTLNVNKFVGLYVQAWKGYGETLIDY
NHDQTRIGLGIKLMPPN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggatgctattaattgcattggcaataccctctttatcgttcgcaaaagag
ttaaatcgtatacatgcctatgaagatagctatattttaggttcttatattagtgatttg
aacaaacaaacctatattgatggtggttttgaagatgctgatggccttcatgatgttgaa
gtgaaattcaaattttcatttgcagtacctttgttcccagttagtcaaagttcctcaatc
atgtttgcttatacacaaaagtcattatggcagttgggtaacagcgatatttcatcccct
tttagagaaactaactataagccacaatttttcttgatgcatcagtcaaatatgttgatt
tttaacaatgctgaatttggttatatgcatgaatctaatggtcaaacagcaagtttatct
cgtagttgggatcgcatttatggcgcattagaacgaattgatggccctgtacaatatggc
gttagagcttggtatgtcattgctgatgaagaaaataacgaagatattacggattattta
ggtaattatgatgtttgggcttctgtcggtaatgatattggaacactcagtactcgtttc
cattataatttcgaaaccgataaaggtggtgctgagcttggttatacattaaacgtcaat
aaatttgttggtttatacgtacaagcatggaaagggtatggggaaaccttaattgattat
aaccatgatcaaactcgaattggtcttggtattaaattaatgccgccaaattaa

DBGET integrated database retrieval system