KEGG   Vibrio fischeri ES114: VF_1914Help
Entry
VF_1914           CDS       T00236                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vfi  Vibrio fischeri ES114
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vfi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vfi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2144250..2145383
Genome map
AA seq 377 aa AA seqDB search
MSDTPTLALAKDLLSRQSITPEDAGCQELMIKQLEALGFTIEIMVFEDTTNFWARRGNKA
PLFTFAGHTDVVPTGDLTHWNTNPFEPTIIDGMLYARGAADMKGSLACMVVAVERFVAEH
PNHKGSISFLITSDEEGPFINGTTRVVDTLQERNEIIDMCIVGEPSSTAHVGDVVKNGRR
GSLTGNLTVKGIQGHVAYPHIARNPIHQAMPALSELATTVWDNGNDYFPPTSFQIPNMNG
GTGASNVIPGTVDIMFNFRFSTESTVDELQQRVVEILDKHDLEYELDWIINGLPFLTDTG
DLLTAVVNAVDTVNQQKPQLLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNECVNVED
LEKLTDMYQEVLNNLLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacaccaacattagctcttgctaaagatttactaagccgccaatccatcaca
cctgaagatgcaggttgccaagagctaatgattaaacaactagaagcacttggttttacc
attgaaattatggtgtttgaagatacaaccaacttttgggctcgtcgaggcaataaagca
ccattatttacttttgcaggacatacggatgttgttcctacaggtgatttaacgcattgg
aataccaatccatttgagccaacaatcattgatggaatgctctacgctcgtggagcagct
gatatgaagggctctttagcttgtatggtggttgccgttgagcgtttcgtcgcagagcac
cctaatcacaaaggttcaatttcatttttaatcacatccgatgaagaaggtccatttatt
aatggcacgactcgtgtagtggataccctgcaagaacgtaacgaaatcattgatatgtgt
atcgtaggcgaaccatcaagtaccgctcatgttggtgatgtggttaaaaatggacgtaga
ggctcattaacaggtaatttaaccgttaaagggattcaagggcatgttgcgtatccgcat
atagctcgcaatccaattcaccaagcgatgcccgctctgtcagagctagcaacgaccgtt
tgggacaatggcaatgattattttccaccaacaagctttcaaatcccaaatatgaatggt
ggcacaggcgcttctaacgttattcctggcacagttgatatcatgtttaactttagattc
agtacagaatcaacagtagatgagctacaacaacgtgtcgtcgaaattttagataagcat
gatttagaatacgaactagattggattatcaatggcctccctttcctaactgatactggg
gatttattaacagccgttgttaatgctgtcgatacggttaatcaacaaaaaccacaatta
ttaacgacaggtggtacgtcagatgggcgttttattgctcaaatgggttcccaagttata
gagcttggccctgtgaatgcgaccatccataaagtaaatgagtgcgtaaatgtagaagat
ttagaaaagctaactgatatgtatcaagaagtcctaaataatctactagcataa

DBGET integrated database retrieval system