KEGG   Vibrio fischeri ES114: VF_1956Help
Entry
VF_1956           CDS       T00236                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vfi  Vibrio fischeri ES114
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vfi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2186491..2187693)
Genome map
AA seq 400 aa AA seqDB search
MRKLTILGATGSIGSSTLSVAKQNSDQFEVVALGAGTNVDKMLELCLEWKPKYVAMATQP
AADELKELLSAHAINAEVFSGEDGLCHIAQLDEVDTVMAAIVGAAGLLPTMSAVKAGKRI
LLANKEALVMSGQLFIDAVEKYGAELLPVDSEHNAIFQCLPQSIQTNLGRCDLEEHGVSS
ILLTGSGGPFRYTDVSELEAVTPEMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFN
ASKDQLKVVIHPQSVIHSMVQYKDGSVLAQMGLPDMRTPIACTMSYPKRVDAGVEPLDFT
KVGEFTFIAPDFARYPCLKLAIDACYLGQHATTGLNAANEQAVAAFLANKIKFTDIARIN
EAVLHKVCANFQNLELDSLESLIDLDRMARRYADEAINKV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagttaaccattttaggagcgacaggctctattggtagtagcacactatcagtc
gcaaaacaaaattccgatcaatttgaagttgtagcattaggtgcaggtactaatgtcgat
aaaatgttggagctatgccttgaatggaaaccaaagtacgttgcaatggcaactcaacct
gctgctgatgagttaaaagaactattatcagctcacgcgattaatgctgaagtattctca
ggtgaagatggcttatgtcatattgcgcaacttgacgaagttgatactgttatggctgca
attgtaggggctgcagggcttctacctaccatgtcggcagttaaagctggtaaacgtatt
ttgcttgctaataaagaagctttggtcatgtctgggcagctatttattgatgcggttgaa
aagtacggtgctgaattactgccagtggatagtgaacataacgctatctttcagtgttta
ccgcaatcaattcaaaccaatttaggtcgttgcgatttagaagagcacggcgttagttct
attttattaactggttctggtggtccttttcgttataccgatgtatcagagcttgaagct
gtaacgcctgaaatggcaattgcgcaccctaattggtctatggggccaaagatctctgtc
gattcagcgacgatgatgaacaaaggccttgagtatattgaggctcgttggttattcaat
gcgagtaaagatcaattaaaggttgttattcatccgcaatcagtaattcattcaatggtt
caatataaagacggctctgtgttggcacaaatgggactgccagatatgagaacacctatt
gcgtgtactatgtcttatccaaaaagagttgatgcaggtgttgaacctttagattttact
aaagttggagagtttacgtttattgctcctgattttgctcgttatccttgtttgaaacta
gccattgatgcgtgctatttaggacaacatgcaactacggggctaaatgctgcgaacgag
caagctgttgctgcctttttagccaataaaataaaatttacagatatcgctcgaattaat
gaggctgttttgcataaagtctgtgcaaacttccaaaaccttgagctagatagcttggaa
agcctgattgacctagatagaatggcgcgtcgttatgccgatgaggcaattaataaggtt
taa

DBGET integrated database retrieval system