KEGG   Aliivibrio fischeri ES114: VF_2055Help
Entry
VF_2055           CDS       T00236                                 

Gene name
yhjA
Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vfi  Aliivibrio fischeri ES114
Brite
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VF_2055 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2286694..2288079)
Genome map
AA seq 461 aa AA seqDB search
MKKIGLVVGLGVVAYLGTVYIVDSSDEALSQRKLAQAQIKDDPISSAAFKVLTENGCGYC
HTENSEMPFYANFPIAKQIMQKDVESGLRHFQFDDVLNSFQVGNEVSDVALAKISGVLND
ESMPPKAYLSMHWRSSLSNEEKHTLRAWIKQEQKNKHSLASSEYKYEAVQPINAHVTVDE
QKVALGDALYHDKRLSGDNTVACSSCHSLSTGGVDRLTTSTGINGSKGPINAPTVFNSSY
NIHQFWDGRANDLQEQAGGPPMNPIEMGSASWEQITGKLELDEEMKATFAKIYPDGITGE
NITDAIAEFEKTLITPNSRFDQFLKGDALALNEQEQHGYELFKQNKCSTCHAGQAMGGQT
FEVMGLKADYFGERGNVSEVDNGRFNVTSKAHDMNRFKVPTLRNIALTAPYFHDGSAETL
DDAVAAMAQYQVGVTLSKSEVEDISAYLKTLTGEYKGEMLN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataggattagtagttggtttaggcgtcgttgcttatcttggaacggtttac
attgttgattcatcagatgaagcgcttagccaaagaaaattagctcaagcacagattaaa
gatgacccaatctcttctgctgcgtttaaagtattaacagagaacggctgtggttactgc
catactgaaaatagcgaaatgcctttttatgctaactttccaatcgctaaacagatcatg
caaaaagatgtggagagtggactacgtcatttccaatttgatgatgtattaaatagtttt
caagttggcaatgaagtttcagatgttgccttagctaaaatcagtggtgtattgaatgat
gaatcaatgccaccaaaagcgtatttgtcgatgcactggagatcaagtttatctaatgaa
gaaaaacatactctacgcgcttggataaagcaggaacaaaagaataaacactcattggct
agtagtgaatataaatacgaagcggttcaaccgattaacgcacatgtcactgtagatgaa
caaaaagtggcattaggtgatgcgttataccacgataaacgtctttctggtgataacacg
gtagcttgttctagctgtcattcattatcaacgggcggagtagatagattaactacatca
acgggtattaatggttcaaaaggcccaattaatgcgccgacggtgtttaactcatcttat
aatatccaccaattctgggatggtcgtgcgaatgacttacaagagcaagcgggtgggcca
ccgatgaatcctatcgagatgggttctgcatcatgggagcaaattacaggtaagcttgaa
cttgatgaagagatgaaagcgacctttgctaagatttaccctgatgggatcacgggtgaa
aacatcaccgatgcgattgctgagtttgagaaaaccttgatcactccgaatagccgattt
gaccaattcttaaaaggcgatgcattagcattaaatgagcaagagcaacacggctatgaa
ttatttaaacaaaacaaatgttcgacgtgtcatgctggtcaagcaatgggtggacaaacg
tttgaagtcatgggattaaaagcggattactttggtgagcgaggtaatgtatctgaggtg
gataatggtcgttttaatgtgacgagtaaagcacatgatatgaaccgttttaaagttccg
acgctaagaaatattgcactaacagcaccttatttccatgatggtagtgccgaaacacta
gatgacgcagttgctgcaatggcgcaataccaagttggtgtgactttatctaaaagtgaa
gttgaagatattagcgcttatttgaaaaccttaactggtgagtacaaaggtgaaatgctg
aattaa

DBGET integrated database retrieval system