KEGG   Vibrio fischeri ES114: VF_2146Help
Entry
VF_2146           CDS       T00236                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vfi  Vibrio fischeri ES114
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vfi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vfi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2399691..2401598
Genome map
AA seq 635 aa AA seqDB search
MMDYRVDLVVLSDKEKLNRFGLTLHNLSDVDLHHWQLQFTIDRFIAPESNSQGTLEQVGS
FCKLTPDANQVLKANNHYYVEFSIGTAPFRFITDGLDDAAIFVDDGKNTHFLDVSISPIV
LASPYSERTSIPRVAPSELSLIPKPESVQRFDGQFNLKDKISLETQTHLAQGAAQWLSDE
LENITSLKYPIKSQGQIQFIANPTLDKGAYQLSVSEDIITLTAGSNEGFVHASATLLQLI
NERTHLIPCAKIKDQPRFHYRGMMLDCARHFHPLERVKRLINQLAHYKFNTFHWHLTDDE
GWRVEIKAFPELTQIGAWRGPEEVIEPQYTHIAEKHGGYYSQEEIKDVIAYAEQRGITVI
PEIDIPGHCRAAIKSLPHLLIDSDDNSVYRSIQHYTDNVLSPAIEGTYQFIDTVLEEIAD
LFPAPYVHIGADEVPKGVWTDSEKCQKLMEEQGYSDPVELQGHLLRHAENKLKQLGKQML
GWEEAQHGNKVSKDTVIYSWLSEEAALNCAKQGFDVVLQPGQTTYLDMAQDYAPEEPGVD
WANVLPLEEAYNYEPLAELADNDPIRKRILGIQCALWCEIINNQERMDYMIFPRLLAISE
GMWTQKQHRNWTDFLARLNGRLPTLTRQGINFRQP
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatggattatcgtgtagaccttgttgtcttatcagacaaagaaaagttaaaccgtttt
ggcttaaccttacataatttaagcgatgtggatcttcatcattggcaattacaatttact
attgatcgttttattgcacctgaaagtaattcccaaggaacattagaacaagtcggtagt
ttttgtaaattaactccagatgccaaccaagtactaaaagcaaataatcactattatgtt
gaatttagtattggtaccgcaccttttcgctttatcaccgatggtttagatgatgccgct
atttttgttgatgatggcaaaaatactcattttttagatgtatcgatctcaccgattgtt
ttggcttcaccatactcagagagaacgtctatccctagagttgctccttctgaactgtct
cttattccaaaaccagaatcagtacaacgttttgatggccaatttaatctaaaagataaa
atctctctagaaacacaaacccatttagcacaaggtgccgcccagtggttaagtgatgaa
ttagaaaacattacttctttaaagtatccgattaaatcacaaggtcagatccaattcatt
gctaatccaacattagataaaggtgcatatcaactttcagtatctgaagatatcatcact
cttactgcaggctctaatgagggattcgttcacgcatctgcgacgcttttgcaattaata
aatgaaagaacacacttaatcccgtgtgcaaaaatcaaagaccaaccacgctttcactat
cgtggaatgatgctagattgtgcaagacacttccatccactagagcgtgtaaaacgttta
attaatcaattagctcattataaatttaacactttccattggcatttaacggatgacgaa
ggatggcgagtagaaataaaagcctttcctgaattaacgcaaattggtgcatggcgtggg
ccagaagaagtgattgagccacaatacactcatatagcagaaaagcatggtggttattat
tctcaagaagagattaaagacgtcattgcttatgcagaacagcgtggaataacagtaata
cctgaaatcgatattccaggccattgccgtgcagctattaaatcactacctcatttgtta
attgattctgacgataattcggtttatcgcagtattcaacactacacagataatgtgcta
tcaccggcaatcgaaggtacctatcaatttattgatactgtgctcgaagaaattgcagat
cttttccctgcaccatacgttcatattggtgcagatgaagttccaaaaggggtttggact
gatagtgaaaaatgtcaaaaattaatggaagagcaaggttatagcgaccctgttgaattg
caaggtcacctacttcgtcatgctgaaaacaaattaaaacaactaggcaaacagatgctt
ggttgggaagaagctcagcatggtaataaagtcagcaaagataccgttatttactcttgg
ttaagtgaagaagcagcattaaattgtgccaaacaaggttttgatgtcgtactccaaccc
ggtcaaaccacctatttagatatggcacaagattatgctcctgaagagcctggagtagat
tgggcaaatgttcttcctcttgaagaggcttataactacgaacctcttgctgaattagct
gataacgaccctattcgtaaacgcattctcggaattcaatgtgcactttggtgtgaaatc
atcaataaccaagagcgcatggattacatgattttcccacgtcttttagcaatatctgaa
ggaatgtggacacaaaaacaacacagaaactggacagactttttagcaaggttaaatgga
cgattaccaaccctaacacgtcagggtattaatttccgtcaaccataa

DBGET integrated database retrieval system