KEGG   Aliivibrio fischeri ES114: VF_2179Help
Entry
VF_2179           CDS       T00236                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00010  Glycolysis / Gluconeogenesis
vfi00020  Citrate cycle (TCA cycle)
vfi00620  Pyruvate metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi01130  Biosynthesis of antibiotics
vfi01200  Carbon metabolism
Module
vfi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_2179 (aceF)
   00020 Citrate cycle (TCA cycle)
    VF_2179 (aceF)
   00620 Pyruvate metabolism
    VF_2179 (aceF)
Enzymes [BR:vfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VF_2179 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 HlyD_3 NQRA
Motif
Other DBs
NCBI-GeneID: 3277732
NCBI-ProteinID: YP_205562
UniProt: Q5E2S2
Position
I:complement(2448932..2450818)
Genome map
AA seq 628 aa AA seqDB search
MTIEINVPDIGADEVEVTEILVKVGDRVEEEQSLITVEGDKASMEVPASQAGIVKEIKIA
EGDSVTTGSLIMIFEAEGAAEAPAAPAVEAAPVAAPAAASVAELKEVHVPDIGGDEVEVT
EIMVAVGDTVEEEQSLLTVEGDKASMEVPAPFAGTVKEIKIASGDSVSTGSLVMIFEVAG
SAPAAPEVEAAAPVAAAPAASAEKEVNVPDIGGDEVEVTEIMVAVGDTVEEEQSLITVEG
DKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMTFVVEGTAPAAPQAAAAPAAQAAPAAA
PVATASAPASTGEFEANNDYAHASPVVRRLAREFGVNLAKVKGTGRKNRILKEDVQGFVK
DALKRLESGAAASGKGGDGSALGLLPWPKVDFSKFGETEVQKLSKIKKISGANLHRNWVM
IPHVTQWDNADITELEAFRKEQNAIEAKNDTGMKITPLVFIMKAVAKALEAFPAFNSSLS
EDGESIILKKYVNVGIAVDTPNGLVVPVFKDVNKKGIYELSEELMAVSKKARAGKLTASD
MQGGCFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEIKPVWNGKEFAPRLQLPLSLSYD
HRVIDGAEGARFITFLNSALSDIRRLVL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattaatgtacctgacatcggtgcagatgaggttgaagtaactgagatt
ctagttaaggtcggtgaccgagttgaagaagagcagtcactgatcactgttgaaggcgat
aaagcttctatggaagttcctgcgtctcaagcgggtatcgttaaagagatcaaaattgct
gaaggtgattcagtaacaactggttctcttattatgatctttgaagcagagggtgctgca
gaagcacctgctgctccagcagttgaagcagcaccagttgctgctcctgctgcagcatca
gttgcagagcttaaagaagttcacgttcctgatatcggtggtgatgaagttgaagtaact
gaaatcatggttgctgttggcgatacagtagaagaagagcaatctcttttaactgttgaa
ggcgacaaagcgtctatggaagttccagctccattcgcaggtacggtaaaagaaatcaaa
attgcttctggtgactcagtatcaactggttctctagtgatgatctttgaagttgcaggt
tcagcaccagctgcaccagaagttgaagcggcagcgccagttgcagcagctcctgcggca
tctgcagagaaagaagtgaacgttccagatatcggcggtgatgaagttgaagtaactgaa
atcatggttgctgttggtgatacagtagaagaagagcaatctctaattactgttgaaggc
gacaaagcatcaatggaagttcctgctccatttgctggtacagtaaaagaaattaagatt
gctgcaggcgataaagtatcgactggctctctaatcatgacatttgttgttgaaggtacg
gcaccagcagctcctcaagcggcagcagccccagctgcacaagcagctcctgcagcggcg
ccagttgcaacagcttctgctcctgcatcaacaggtgaatttgaagcgaacaacgattac
gctcatgcgtctccagttgtacgtcgtcttgctcgtgaatttggtgtaaacctagcgaaa
gttaaaggtactggccgtaagaaccgtatccttaaagaagacgttcaaggtttcgtgaaa
gatgcgcttaaacgtcttgagtctggtgcagctgcatcaggtaaaggtggtgacggttca
gctcttggtttacttccttggccaaaagttgatttcagcaagtttggtgaaacagaagtt
cagaaactttctaagatcaagaagatttctggtgcaaacctacaccgtaactgggtaatg
atccctcacgttacacagtgggataacgcagacatcactgaactagaagcattccgtaaa
gagcaaaatgcaattgaagctaaaaatgatacaggcatgaagatcacgccacttgtattc
attatgaaagcggttgctaaagcacttgaagcgttcccagcgtttaactcttctctatct
gaagatggcgaaagcatcattcttaagaagtacgtaaacgtaggtatcgcagttgatacg
ccaaatggcctagttgttcctgtatttaaagacgtgaacaaaaaaggtatttacgagcta
tctgaagagctaatggctgtttctaagaaagcacgtgctggtaaactaacagcttctgat
atgcaaggcggttgtttcacaatctcaagccttggtggtatcggtggtactgcatttaca
ccaatcgtaaatgcaccagaagttggtatcctaggtgtttctaagtctgagattaaacct
gtatggaatggcaaagagttcgctccgcgtctacaacttccactgtctctgtcttatgac
caccgtgttatcgatggcgcagaaggtgctcgtttcattactttcttaaacagtgcatta
tcagacattcgtcgtctagtactgtaa

DBGET integrated database retrieval system