KEGG   Aliivibrio fischeri ES114: VF_2340Help
Entry
VF_2340           CDS       T00236                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VF_2340 (pfkA)
   01230 Biosynthesis of amino acids
    VF_2340 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VF_2340 (pfkA)
   00030 Pentose phosphate pathway
    VF_2340 (pfkA)
   00051 Fructose and mannose metabolism
    VF_2340 (pfkA)
   00052 Galactose metabolism
    VF_2340 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VF_2340 (pfkA)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VF_2340 (pfkA)
Protein phosphatases and associated proteins [BR:vfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VF_2340 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2629060..2630022)
Genome map
AA seq 320 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSD
MINRGGTFLGSARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLM
SAIAGGCEYVITPETGLNKEALIQNIQDGIAKGKKHAIIAITELMTDVNQLAKEIEAETG
RETRATVLGHIQRGGQPGAFDRILASRMGNYGVKLLIDGHGGRCVGIQNEQLVHHDIIDA
IENMRRPEKLELYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagattggtgttttaacaagtggtggcgatgcgccgggtatgaatgcggca
gttcgtggtgttgttcgtacagcattgacggaaggcctagaagtatttggtattcatgat
ggctacttaggtcttgttgaagatcgtatcgaaaaattagagcgtcacagcgtatctgat
atgatcaaccgcggcggtacattcttaggttcagcacgttttcctgagtttaaagaagta
gctgttcgtgaaaaagcgatcgaaaaccttaagaaacacgacattgatgcgctaatcgtt
atcggtggtgacggttcttacatgggtgcgaagaaattaactgaaatgggttacccatgt
atcggtcttcctggcacaatcgataatgatatcgcgggtactgactacacaattggttac
ctaacagcattaaacactgttattgatgcaattgaccgtctacgtgacacgtcttcttct
caccaacgtatttctattgtagaagttatgggtcgtcactgtggtgatttaactcttatg
tctgcaattgctggtggttgtgagtacgttattactcctgaaacaggtttaaacaaagaa
gctctgattcaaaatatccaagatggtattgcgaaaggtaaaaaacacgcaatcatcgcg
atcactgagctgatgacagatgttaaccaacttgcaaaagaaatcgaagctgaaacgggt
cgtgaaactcgtgcaacggttcttggtcacattcagcgtggtggtcaacctggtgcattc
gaccgtatcctagcttctcgtatgggtaactatggtgtgaaattgctgattgatggtcac
ggtggccgttgtgttggtattcaaaatgaacaacttgttcaccacgatatcatcgatgca
attgaaaacatgcgtcgtccagaaaaacttgagctatacaaagtagctgaagagttattc
taa

DBGET integrated database retrieval system