KEGG   Vibrio fischeri ES114: VF_2462Help
Entry
VF_2462           CDS       T00236                                 

Gene name
cysQ
Definition
adenosine 3'-phosphate 5'-phosphosulfate 3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vfi  Vibrio fischeri ES114
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vfi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2760455..2761273)
Genome map
AA seq 272 aa AA seqDB search
MDSTLSHLIPEVINIARASGQLILDIYEKGDFEEFIKSDETPVTSADLAAHKLIIEKLSQ
LTPDIPILSEEDAGISLEQRAQWERYGLVDPLDGTQEFIARSGDFATIIALVENNRPVMG
VVYGPVSGVTYYAYEGKGAWKIPDMDESVRISTLKHEDEKQPIAIAISRRQDINNITRCM
SSDWNYDLVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVQEAGGRILSTELE
PLSYNERESLENPNFIVLGDENLPWNNILTCK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattctacactttctcaccttatccctgaggtgatcaatattgcacgtgcatcgggt
caactcattctcgatatatacgagaaaggagatttcgaagagttcattaagtcagatgaa
actccggtgaccagtgctgatctcgccgctcataaattaattatcgaaaaactttctcaa
ctaacaccagatattcctattctttctgaagaagatgcagggatatctttagagcaacgt
gctcaatgggagcgttatgggttggttgaccctcttgatggtacgcaagagttcatcgct
cgcagtggtgattttgctacgattattgctttagttgaaaataaccgtccagtaatgggg
gttgtatatggcccagtttctggtgtgacgtactacgcctatgaagggaaaggtgcgtgg
aaaattcctgatatggatgaaagtgttcgtattagcacgttaaagcatgaagatgaaaaa
cagccaattgcgatagcgatcagtcgacgccaagatatcaataacataacacgttgtatg
agttctgattggaattacgatttggttccattagggtcagctgcacttaaagcctgtttg
gtcgcagaaggtgctgtggattgttatttacgattaggaccaactggcgaatgggatacg
gctgcaacccagtgtattgttcaagaagcgggaggtcgcatcttatcgacagagcttgaa
ccgctttcttataatgaacgagagtcattagaaaacccgaattttattgttctcggtgac
gaaaatttaccgtggaataacattcttacatgtaaataa

DBGET integrated database retrieval system