KEGG   Aliivibrio fischeri ES114: VF_2481Help
Entry
VF_2481           CDS       T00236                                 

Gene name
pldB
Definition
lysophospholipase L(2) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VF_2481 (pldB)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VF_2481 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2780479..2781447
Genome map
AA seq 322 aa AA seqDB search
MKAATFTQETHYLETMKNQVAPFWEKRQHGFYQGEKETQLHWVSFTSPAHTKAIMVVNGR
IESVYKYQELFYDLFCQGYDIYSFDHRGQGLSDRLTDNNDIGHIEDFNDYVLDLNSLTQS
LITPEHYQDCYLLGHSMGGAIATQYIETHSHPYTALALSAPMHGIHMQPWLKPIANPISR
YLSLWSKQPSYALGQAPYHAKPFLDNALTTCEIRYQWFRELYDTKPELQIGGPSNHWVNQ
GLKGAKLCVDQAAQCTLPTLLLQGEKDQIVDNNAHVKFQKKAPDCQLITISDAKHELLFE
TDECRNQALVAIIDFFQQHSHV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgacctttactcaagaaacgcattaccttgaaaccatgaaaaaccaagta
gcccctttttgggagaaacgccaacacggtttttatcaaggagagaaggaaacacaactt
cattgggtaagttttacgagccctgctcacaccaaagcgatcatggttgttaacggacga
attgaaagtgtctataaataccaagagctattttatgatttattctgccaaggctatgat
atttattctttcgatcaccgtggccaaggtctgtccgatcgcctaacggataataatgat
attggtcatattgaagactttaatgattacgttctcgatttaaatagcctaactcaatca
ttaatcacacctgagcattaccaagactgctatctactcggtcattcaatgggaggggca
attgcaactcaatacattgaaactcactctcacccctacaccgctttagcattaagtgct
ccaatgcatggtattcatatgcaaccttggctaaagcccattgcaaacccaattagtcgc
tacttaagcttatggtcaaaacagccttcttacgccttaggccaagcgccatatcatgca
aaaccatttttagataatgcgctcactacttgtgaaattcgctatcagtggtttagagaa
ctctatgacaccaaaccagaattgcagatcggtggtccaagcaatcattgggttaatcag
ggattaaaaggggcaaagctatgtgttgaccaagcagcacaatgcacacttccaacctta
ttacttcaaggtgaaaaagaccaaatcgttgataataatgcgcatgtgaagtttcagaaa
aaagcaccagattgccaattaataaccatttctgatgcgaaacatgaattgctgtttgag
acggatgaatgccgcaaccaagcattagttgctatcattgattttttccagcaacactct
cacgtgtga

DBGET integrated database retrieval system