KEGG   Vibrio fischeri ES114: VF_A0236Help
Entry
VF_A0236          CDS       T00236                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vfi  Vibrio fischeri ES114
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vfi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:259348..260862
Genome map
AA seq 504 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVILDHDANIVSVSQREFTQIYPEAGWVEHDPLEIYATQSST
LVETLAKAGIRSDQIAGIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADTCEKLKEAG
LEEYIRENTGLVVDPYFSGTKIKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMVFNINTLQWDEKLLKELDIPLSMMPEVKSSSEVYGETNIGGKGGTRIPI
AGIAGDQQAALYGQMCVEQGQAKNTYGTGCFLLMNTGKEKVTSRNGLLTTLACGPRGEAS
YALEGAVFMGGASIQWLRDEMKLLADAKDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGCGSNHIIRATLESIAYQTRDVIDAMQADSGIKLSALRVDGGAVANNFLM
QFQSDVLDVAVHRPKVTEVTALGAAYLAGLAVGFWNGLDELADKAVIDRSFEPHHDEEKR
NQRYRGWKRAVKCAQAWAELHDEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacattgttgcacttgaccaaggtactaccagctctcgtgctgtc
attcttgaccacgatgcgaatattgtcagtgtttctcagcgtgaatttactcagatttat
ccagaagctggatgggttgagcatgatccactagaaatctacgcaacacaaagctctaca
cttgtcgaaacgttagcaaaagcggggatccgaagtgatcaaatcgcaggtatcggtatt
actaatcagcgtgaaacaacaattgtctggaataaagagacgggtaagcctgtatataac
gcaattgtttggcagtgtcgtcgaactgctgatacttgtgaaaaattaaaagaagcagga
ttagaagaatatattcgtgaaaatactggtttagttgttgacccatacttttcgggaacc
aaaattaagtggattctagataacgtagagggtgcacgagaagatgctgaagcaggcaag
ctattgtttggtaccgtagatacttggcttgtgtggaaaatgacacaaggacgcgttcat
gtgacagattatactaatgcgtcacgtactatggtgtttaatatcaatacacttcaatgg
gatgaaaaactgctaaaagaattagatattccactttcaatgatgcctgaagtgaaatca
tcatcagaagtatatggtgaaacaaacataggtggtaaaggcggaacacgtattcctatt
gcaggcattgcaggtgatcagcaagcagcactctatgggcaaatgtgtgttgaacaaggt
caagcaaaaaatacctatggaactggttgcttcttgttaatgaatactggaaaagaaaaa
gtaacctctcgtaatggcctactaactacattagcttgtggtcctagaggtgaagcatct
tatgcccttgaaggtgcagtgtttatgggcggggcttctatccaatggttacgtgatgag
atgaaattattggccgatgctaaagattcagagtattttgcgaccaaagtagacacctct
aatggtgtatatgttgttcctgcttttactggtcttggcgcgccatattgggatgcttat
gcacgcggtacgattgtaggcttaactcgtggttgtggctctaaccatattattcgtgca
acgctagaaagtattgcttatcaaactcgtgatgtaattgatgctatgcaggcggattcc
ggcattaaattatctgcacttcgtgttgatggtggtgcggtagcgaataatttcttaatg
caattccaatcggatgttttagatgttgcggttcatcgtccaaaagttactgaagtaacg
gctcttggtgcggcatatcttgctggtctagcggtcggtttctggaatggtttagatgag
ctagcagataaggccgtcattgatcgttcgtttgaaccacatcatgatgaggagaaacgt
aatcagcgttatcgtggttggaaacgagcagtaaaatgtgcgcaagcttgggcagagtta
catgatgaagagtaa

DBGET integrated database retrieval system