KEGG   Aliivibrio fischeri ES114: VF_A0257Help
Entry
VF_A0257          CDS       T00236                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VF_A0257
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VF_A0257
   00630 Glyoxylate and dicarboxylate metabolism
    VF_A0257
Enzymes [BR:vfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VF_A0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(287878..288489)
Genome map
AA seq 203 aa AA seqDB search
MLIIKSVLDKDFFEGTIMAITNINKESNTQHETPFMAEAVYAVEKMEAKQEEKQHQIKGL
LDQLFPLTKGSHQDVTNYLLDYHHLVVFFKDGGCSGLRNPGKFVAFTGHRSSPDTILLKD
NSGSHVEIIFGLHTPGKDSLVTIADVEIETCTTFSQDFSLAAMRHWISLIKRDSSSHIKA
HQVDKEYTAKNGDEYQLNSCFSL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgataattaaatcggtattagataaagactttttcgagggtaccattatggcgatt
accaatataaacaaagaaagtaatacacaacatgaaactccgtttatggctgaagctgtt
tatgccgtcgaaaaaatggaagcaaaacaagaagagaaacaacatcaaatcaaaggtctt
cttgaccaattattcccactaacaaaaggctcacatcaagacgttactaactacttactt
gattatcatcatttagtagttttctttaaagatggtggttgcagtggattacgcaatcca
ggaaaatttgttgctttcacaggacacagatcatcgcctgatactattttattaaaagac
aacagtggcagtcatgttgaaattatttttggtcttcatacgccaggtaaagattcactg
gttaccatagctgatgtagaaatagaaacatgcacaacgttcagtcaggactttagctta
gcggctatgcgtcattggattagtttaataaagcgtgacagcagttcacacattaaagct
catcaagtagataaagaatatacagccaagaatggagatgaataccaacttaacagctgt
tttagtctttaa

DBGET integrated database retrieval system