KEGG   Aliivibrio fischeri ES114: VF_A0257Help
Entry
VF_A0257          CDS       T00236                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VF_A0257
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VF_A0257
   00630 Glyoxylate and dicarboxylate metabolism
    VF_A0257
Enzymes [BR:vfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VF_A0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(287878..288489)
Genome map
AA seq 203 aa AA seqDB search
MLIIKSVLDKDFFEGTIMAITNINKESNTQHETPFMAEAVYAVEKMEAKQEEKQHQIKGL
LDQLFPLTKGSHQDVTNYLLDYHHLVVFFKDGGCSGLRNPGKFVAFTGHRSSPDTILLKD
NSGSHVEIIFGLHTPGKDSLVTIADVEIETCTTFSQDFSLAAMRHWISLIKRDSSSHIKA
HQVDKEYTAKNGDEYQLNSCFSL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgataattaaatcggtattagataaagactttttcgagggtaccattatggcgatt
accaatataaacaaagaaagtaatacacaacatgaaactccgtttatggctgaagctgtt
tatgccgtcgaaaaaatggaagcaaaacaagaagagaaacaacatcaaatcaaaggtctt
cttgaccaattattcccactaacaaaaggctcacatcaagacgttactaactacttactt
gattatcatcatttagtagttttctttaaagatggtggttgcagtggattacgcaatcca
ggaaaatttgttgctttcacaggacacagatcatcgcctgatactattttattaaaagac
aacagtggcagtcatgttgaaattatttttggtcttcatacgccaggtaaagattcactg
gttaccatagctgatgtagaaatagaaacatgcacaacgttcagtcaggactttagctta
gcggctatgcgtcattggattagtttaataaagcgtgacagcagttcacacattaaagct
catcaagtagataaagaatatacagccaagaatggagatgaataccaacttaacagctgt
tttagtctttaa

DBGET integrated database retrieval system