KEGG   Vibrio fischeri ES114: VF_A0301Help
Entry
VF_A0301          CDS       T00236                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vfi  Vibrio fischeri ES114
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vfi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:vfi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vfi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:334332..336071
Genome map
AA seq 579 aa AA seqDB search
MMNPLFFLCGQESIPVQTDLIYEFQNDQISMHFSGIHNLPINDHYLILQFPTQLEHDAKI
LGDGFQMLAQTGGKVDSPQEIGRCPDNSPSYRIYSEHAKKRFYNYLVIEQSDGFTLFGFT
SCYRFAGYFEIHEYQGSMNVMAFLDGEFTHPQDWASNRMESLTVIKAESLAELYELYAAK
VQQQHPIRPGVKQDAPIGWCSWYAYYADVTEKNVLDNVEVMCQKDSEFEWVLLDDGYQAF
MGDWLTPSDKFPNGIKALLQDIKAKGKKPAIWIAPFIAQPESDIFKNHPDWFVHHENGEL
LKAEDITYGGWRCTPWYILDTSKQEVQIHLTEVIHTMREEWGVELFKLDANYWGTLKGKR
TQSGITGIEAYRLGMQAITNGAGDALILGCNAPMWPSLGLVDAMRVSDDVERNPQRFEQI
AKETFYRSWQHRKLWQIDPDCVTLISLSNQGTERKYYEFHRNVILASGGLALSGDPLPDL
NKFAKKTWKNILSRLRLTQEAAQFTSLSNRHCTLTLNHQHELHCLFNYDDEAMEHTLVAD
QPSIWRDFWTGEQLNEEPTQMLILTLDSGLNSKAILVSN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacccactatttttcttatgtggacaagaaagtatcccggtacaaaccgattta
atctatgaattccaaaatgatcaaatatcgatgcatttttcaggtattcataatcttcca
attaatgatcattaccttattctgcaatttccaacccaattagagcatgacgcaaaaatt
ttgggggatggttttcaaatgcttgctcagacaggcggaaaagttgactcaccacaagag
atcggccgctgtcctgataatagtcctagttatcgaatttattcagagcacgcaaaaaaa
agattttataattatttagtgattgaacaatcagacggatttactctctttggttttact
tcttgttatcgatttgcaggttatttcgagatacatgaatatcaaggttcaatgaatgta
atggcatttcttgatggtgaattcactcatccacaagattgggctagtaatcgaatggag
tcattaacggttattaaggctgagtctttagctgagttatatgagctttatgcagccaaa
gtacaacagcagcacccaattcgaccaggagtaaaacaagacgctccaattggttggtgc
tcatggtatgcctactatgcagacgttacagagaaaaacgttttagataatgttgaggtc
atgtgccaaaaagactctgaatttgagtgggtgcttcttgacgacggatatcaagctttc
atgggagactggttaacaccttcagataaatttcctaatggtataaaagcactattacaa
gatataaaagcaaaaggaaagaaacctgctatttggatagctccatttattgcacaacct
gaatcagacatttttaaaaatcacccagattggtttgttcatcacgagaatggtgaatta
ttaaaagcagaagatattacttatggtggctggcgttgtacgccttggtatatccttgat
acttcaaaacaagaagttcaaatacatttaacagaagttatccacaccatgagggaagag
tggggagtagagctgtttaaactggatgctaattattggggtacgcttaaaggtaagcga
acacaatcagggatcacgggtattgaggcttatcgattaggtatgcaagctattacaaac
ggggctggtgatgcgttaattcttggctgtaatgcgccaatgtggccatcattgggtcta
gttgatgcaatgcgagtatctgatgatgtcgaacgtaatcctcaacgttttgaacagata
gcaaaagagacattttaccgtagctggcagcaccgtaaattatggcaaattgatcctgat
tgcgtcacgttgatctcactgtctaaccaaggtacggaacgaaaatattatgaatttcat
cgaaatgtgattttagcttctggtgggcttgcattgtctggtgatccgttaccagatttg
aataaattcgcaaagaaaacatggaagaatattttgtctcgtcttcgtttaactcaagag
gcggctcagtttacttcattgagtaataggcattgcacattaacactcaatcatcagcat
gaactacattgtttatttaactatgacgatgaagcaatggagcacacccttgttgctgat
cagccatctatttggcgagatttctggacgggggagcagttaaatgaagaaccaacacag
atgttaattttaactttagatagtggattgaacagtaaagctatcttagtttcaaattaa

DBGET integrated database retrieval system