KEGG   Aliivibrio fischeri ES114: VF_A0301Help
Entry
VF_A0301          CDS       T00236                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VF_A0301
  Lipid metabolism
   00561 Glycerolipid metabolism
    VF_A0301
   00600 Sphingolipid metabolism
    VF_A0301
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VF_A0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:334332..336071
Genome map
AA seq 579 aa AA seqDB search
MMNPLFFLCGQESIPVQTDLIYEFQNDQISMHFSGIHNLPINDHYLILQFPTQLEHDAKI
LGDGFQMLAQTGGKVDSPQEIGRCPDNSPSYRIYSEHAKKRFYNYLVIEQSDGFTLFGFT
SCYRFAGYFEIHEYQGSMNVMAFLDGEFTHPQDWASNRMESLTVIKAESLAELYELYAAK
VQQQHPIRPGVKQDAPIGWCSWYAYYADVTEKNVLDNVEVMCQKDSEFEWVLLDDGYQAF
MGDWLTPSDKFPNGIKALLQDIKAKGKKPAIWIAPFIAQPESDIFKNHPDWFVHHENGEL
LKAEDITYGGWRCTPWYILDTSKQEVQIHLTEVIHTMREEWGVELFKLDANYWGTLKGKR
TQSGITGIEAYRLGMQAITNGAGDALILGCNAPMWPSLGLVDAMRVSDDVERNPQRFEQI
AKETFYRSWQHRKLWQIDPDCVTLISLSNQGTERKYYEFHRNVILASGGLALSGDPLPDL
NKFAKKTWKNILSRLRLTQEAAQFTSLSNRHCTLTLNHQHELHCLFNYDDEAMEHTLVAD
QPSIWRDFWTGEQLNEEPTQMLILTLDSGLNSKAILVSN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacccactatttttcttatgtggacaagaaagtatcccggtacaaaccgattta
atctatgaattccaaaatgatcaaatatcgatgcatttttcaggtattcataatcttcca
attaatgatcattaccttattctgcaatttccaacccaattagagcatgacgcaaaaatt
ttgggggatggttttcaaatgcttgctcagacaggcggaaaagttgactcaccacaagag
atcggccgctgtcctgataatagtcctagttatcgaatttattcagagcacgcaaaaaaa
agattttataattatttagtgattgaacaatcagacggatttactctctttggttttact
tcttgttatcgatttgcaggttatttcgagatacatgaatatcaaggttcaatgaatgta
atggcatttcttgatggtgaattcactcatccacaagattgggctagtaatcgaatggag
tcattaacggttattaaggctgagtctttagctgagttatatgagctttatgcagccaaa
gtacaacagcagcacccaattcgaccaggagtaaaacaagacgctccaattggttggtgc
tcatggtatgcctactatgcagacgttacagagaaaaacgttttagataatgttgaggtc
atgtgccaaaaagactctgaatttgagtgggtgcttcttgacgacggatatcaagctttc
atgggagactggttaacaccttcagataaatttcctaatggtataaaagcactattacaa
gatataaaagcaaaaggaaagaaacctgctatttggatagctccatttattgcacaacct
gaatcagacatttttaaaaatcacccagattggtttgttcatcacgagaatggtgaatta
ttaaaagcagaagatattacttatggtggctggcgttgtacgccttggtatatccttgat
acttcaaaacaagaagttcaaatacatttaacagaagttatccacaccatgagggaagag
tggggagtagagctgtttaaactggatgctaattattggggtacgcttaaaggtaagcga
acacaatcagggatcacgggtattgaggcttatcgattaggtatgcaagctattacaaac
ggggctggtgatgcgttaattcttggctgtaatgcgccaatgtggccatcattgggtcta
gttgatgcaatgcgagtatctgatgatgtcgaacgtaatcctcaacgttttgaacagata
gcaaaagagacattttaccgtagctggcagcaccgtaaattatggcaaattgatcctgat
tgcgtcacgttgatctcactgtctaaccaaggtacggaacgaaaatattatgaatttcat
cgaaatgtgattttagcttctggtgggcttgcattgtctggtgatccgttaccagatttg
aataaattcgcaaagaaaacatggaagaatattttgtctcgtcttcgtttaactcaagag
gcggctcagtttacttcattgagtaataggcattgcacattaacactcaatcatcagcat
gaactacattgtttatttaactatgacgatgaagcaatggagcacacccttgttgctgat
cagccatctatttggcgagatttctggacgggggagcagttaaatgaagaaccaacacag
atgttaattttaactttagatagtggattgaacagtaaagctatcttagtttcaaattaa

DBGET integrated database retrieval system