KEGG   Aliivibrio fischeri ES114: VF_A0347Help
Entry
VF_A0347          CDS       T00236                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VF_A0347 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VF_A0347 (ebgA)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VF_A0347 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(385181..388282)
Genome map
AA seq 1033 aa AA seqDB search
MNNWENFFRLNENRMAPRAYFFSYDSVQAARTFQRELSSHYQLLSGQWTFNFFTNPLLVP
EEFYSQHMSDWGNITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPSDNPTGAYQRTFTLG
ETWNNKQIIIKFDGVETYFEVYVNGNYVGFSKGSRLTAEFDISEFAQQGENLLSVRVMQW
ADSTYIEDQDMWWTGGIFRDVYLVGKEQVHVQDITIRTDFDENYQSATLSCKADLENLTN
NSVSNYSLGYALFDGQTVVSEGTVNSLSFDANHCVDINIDMESPTHWTAENPYLYQLILT
LKDENGKTLEIIPNRVGFRDIKVRDGLFYINNKYVMLHGVNRHDNDHLKGRAVGMDRVEK
DIVLMKQHNINSVRTAHYPNDPRFYELCDVYGLFVMGETDVETHGFANVGDLSRITNDPA
WEHVFVERIERHIHAQKNHASIIMWSLGNESGYGCNIKSMYDAAKAIDDTRLVHYEEDRD
AEVVDIISTMYSRAQLMNAFGEHPHNKPRIICEYAHAMGNGPGGLTEYQNVFYKHDSIQG
HYVWEWCDHGILAKDENGTEFLKYGGDYGDYPNNYNFCMDGLVYSDQTPGPGLKEYKQVI
APVKIRAKDTANGVFTVDNKLWFSNLDDYTITAEIRAEGETLQSTTFKVEGLTENSSRDI
EITLPELDGRETFVNFTVRKNSRTLYSEANHDIAVYQVQLKENTEQLPVFTNSNAIALDI
TASRLDYVVKGLNFALTFSKVNGKLTSWVVNGDELIASAPKLNFFKPMVDNHKQEHEGLW
EPAHLQIMQEHFRSIDLDASNGKATFTVTSIIAPPVFDFGMRCTYVYEINKEGQLNIQLS
GERYGDYPHVIPVIGLDLGINNDFDQVQYYGRGPEENYQDSQQANMIDVYQTTIADMFEN
YPFPQNNGNRQHVRWASLANRHGNGLFVKPEQEINFSAWFYTNQNIHEAQHTIELEKSGY
ITLNLDHKLMGLGSNSWGSEVLDSYRVYMDKFQYALTLVPFQQGGCSPKALANHTFISNT
AFTSKTTIEGGEK
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaattgggaaaacttcttccgcttaaatgagaaccgcatggctccacgcgcttac
ttcttctcatatgactcagttcaagctgctcgtacattccaacgtgaattaagcagtcat
taccaattattaagtggtcaatggacattcaatttctttactaatcctttacttgttcct
gaagaattttattctcaacacatgagtgattggggcaatattacggttcctaacatgtgg
caaatggaaggtcatggcgatcttcaatacacagatgaaggttttcctttcccgattgat
gttccttttgtaccaagcgataacccaacaggtgcttaccaacgcacgttcactttaggt
gaaacatggaacaacaaacaaatcatcatcaaatttgatggtgtagagacttactttgaa
gtctacgtaaatggtaattatgttggttttagtaaaggcagtcgtttaaccgctgaattt
gatatctctgaatttgcacaacaaggtgaaaacctgctatctgttcgtgttatgcaatgg
gctgactccacttacattgaagaccaagacatgtggtggactggcggtatcttccgtgat
gtttacttagtaggtaaagagcaagtacacgttcaagacattactatccgcactgatttt
gatgaaaactaccaaagtgcaacattatcttgtaaagcagatttagaaaacctaacaaat
aactcagtatctaattattcactaggttacgcactgtttgatggtcagactgtcgtttct
gaaggcacagtcaattcgctttcttttgatgcgaaccattgcgttgatatcaatatcgat
atggaaagccctacgcattggacagcagaaaacccttacctataccaactaatcctaact
ctaaaagatgaaaacggtaaaacactagaaatcattccaaatcgagttggtttccgtgat
attaaagtacgcgacggtctgttctacatcaataacaaatacgtcatgcttcatggtgtg
aaccgccacgataacgaccatttaaaaggtcgcgctgtaggtatggaccgtgttgagaaa
gacattgttttaatgaaacaacacaacatcaactcggtacgtactgcacactaccctaac
gacccacgtttttatgaactgtgtgatgtgtacggtctgtttgttatgggtgaaaccgat
gtagaaacgcacggctttgctaacgttggtgatttaagccgcattaccaatgatcctgca
tgggagcatgtatttgtagagcgtattgagcgtcacattcacgcccaaaagaaccacgca
tccatcatcatgtggtcactgggtaacgaatcaggctatggttgtaacatcaaatctatg
tacgatgcagcaaaagcaattgatgacactcgtctagttcattatgaagaagatcgtgat
gctgaagtcgttgatatcatcagtactatgtattctcgtgctcaactaatgaatgctttt
ggtgaacatccacacaataaaccacgtattatttgtgaatacgcacacgcaatgggtaat
ggccctggcggattaactgaataccaaaacgtattctacaagcatgattctattcaaggt
cattacgtatgggaatggtgtgatcacggtattcttgctaaagatgaaaacggcacagag
ttcttaaaatacggcggtgattacggcgattatccaaacaactacaacttctgtatggat
ggcttagtttattcagaccaaactccgggtcctggcttaaaagaatataagcaagttatc
gcgccagttaaaatccgtgcaaaagacacagcaaacggtgttttcactgtcgataacaag
ctatggttctcaaaccttgatgactacaccattaccgctgagatccgtgctgaaggcgaa
acgctacaaagcacaacattcaaagtggaaggcttaactgaaaactcaagccgagatatt
gaaataacactacctgaactggatggacgcgaaacattcgttaatttcacagtacgtaaa
aattctcgcactctatacagcgaagcgaatcacgatattgcggtttaccaagttcaatta
aaagagaacacagagcaactgcctgtcttcacaaacagcaatgcaatcgcacttgatatc
acagcgtctcgtttggattatgtagtaaaagggctgaacttcgcacttactttctcgaaa
gtgaacggtaaattaacctcatgggttgtgaatggtgatgaattaattgcaagcgcacct
aaactgaacttctttaaaccaatggtggataaccataaacaggaacatgaaggtctgtgg
gagcctgcgcaccttcaaatcatgcaagagcatttccgctctatcgaccttgatgcttca
aatggtaaagccactttcacggtaaccagcattattgccccacctgtgtttgattttggt
atgcgttgtacttacgtttacgaaattaacaaagaaggccagctaaacattcaactctct
ggtgagcgttacggtgattaccctcatgttatccctgtaattggtttggatcttggtatc
aacaatgactttgaccaagttcaatactatggtcgtggcccagaagaaaactatcaagac
agccaacaagcaaacatgattgatgtataccaaaccaccattgctgatatgtttgagaac
tacccgttcccacaaaataatggcaaccgtcaacacgttcgttgggcatcgctagctaat
cgtcatggcaatggtttatttgtgaaacctgagcaagaaatcaacttcagtgcttggttc
tacactaaccaaaacattcatgaagcgcagcacaccattgaacttgagaagagtggttat
atcactttaaaccttgaccataagttaatggggttaggttcaaattcatggggttcagaa
gtattagattcataccgtgtttacatggataaattccaatacgcactgactttggttcca
tttcaacaaggtggctgttcaccaaaagcattggcgaatcacacattcatctcaaacaca
gcattcacttcaaaaacaacaattgaaggcggagaaaagtaa

DBGET integrated database retrieval system