KEGG   Aliivibrio fischeri ES114: VF_A0493Help
Entry
VF_A0493          CDS       T00236                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VF_A0493 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VF_A0493 (nagZ)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VF_A0493 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:567421..568416
Genome map
AA seq 331 aa AA seqDB search
MGPLWLDVEGYEIDAEERELLQHPTVGGLILFARNYHDPKQLAALTASIRKAAGRPILIG
VDQEGGRVQRFRDEFTLIPPAQAYAEMDNGLELAKTAGWLLCAELVAHDIDLTFAPVLDN
GFDCKAIGNRAFGDDINTIVKYSTAFMQGMKSAGTSTTGKHFPGHGGVIADSHLETPYDN
RNNIFELDMAIFKAQIEAGILDAMMPAHVIYPEYDSSPASGSSYWLKDVLRKQLSFNGLV
FSDDLSMEGATIMGGPAERSQQALDAGCDMVLMCNNRKSAVEVLDNLAIQSVAKADALLK
TQHFDRKTLLGTREWKEANELITRAYDGWKS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgttatggctagatgttgaaggatatgagattgatgcagaagagcgtgagtta
cttcagcacccaactgttgggggattgattttatttgctcgaaattatcatgatccaaaa
cagttagcggcactgactgcatccattcgtaaagcagcaggtcgaccaattcttatcggt
gtcgatcaagaaggtggacgtgttcagcgctttagagatgagtttactcttattccacca
gcacaagcctatgctgaaatggataacggacttgaactggctaaaacggcgggttggtta
ttatgtgcagagctagtcgctcatgatattgaccttacttttgctccagttttagataat
ggatttgattgtaaagctattggtaatcgtgcttttggcgatgacattaataccattgtt
aagtacagcacagcattcatgcaaggtatgaaatcggcaggaacctcaacgactggtaaa
catttccctggtcatggtggtgttattgctgattcgcatctagaaacaccttacgataac
cgtaacaatatttttgagcttgatatggcaatctttaaagctcaaattgaagcgggaatt
ttagatgcaatgatgcctgctcatgttatttatcctgaatacgattcatcaccagcaagt
gggtcatcatattggttaaaagacgtgcttcgtaagcaacttagcttcaatggtttagtc
ttttcagatgatctaagcatggaaggggcaactatcatgggtggtccagcagagcgctct
caacaagcgttagatgctggctgtgatatggtattgatgtgtaataaccgtaagtcagcg
gtagaagtattggataatcttgctattcagtcagtagctaaagcggatgcattattaaaa
acacagcattttgatagaaaaacattgctaggcacaagagagtggaaagaagcgaatgag
cttatcactcgtgcttatgatggttggaaatcatag

DBGET integrated database retrieval system