KEGG   Vibrio fischeri ES114: VF_A0809Help
Entry
VF_A0809          CDS       T00236                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vfi  Vibrio fischeri ES114
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vfi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(910545..912761)
Genome map
AA seq 738 aa AA seqDB search
MRAVLYCPWRKAMKDNNNVLHQVAELAGLKNSYVSAWGNEAKVSDETLIRLLASLGYDTK
NDKTLLSSAEKKHKKDVLSTVQVVRDNELLQVEMNLGKSARISEFSWKITTEEGEVLEGY
LQSQIVSDERENDGTLLFSLPTLPWGYHKLEVIRKRRKAPYEMTLIVTPKACFKQDAMLK
GKKMWGPSVQLYTLRTPHNWGIGDFGDLKQLVGDIAVRGGDFVGLNPIHSLFPANPEGAS
PYSPSSRRWLNILYIDVCSVPEFALCNQAQELVGSAEFQQRLADARQSHWVNYSEVSALK
MSVLPLLFSEFKTRHLDKKSARAKAFLEFVAEGGESLLHQAAFDALHNSLYSQDNSIWGW
PVFPHELQHFDNKAVQKYIADNRDQVDLYMYLQWVAFTQINDVQQFAENKGMDVGLYRDL
AVGVADSGSETWADHGNLCLDVSIGAPPDILGPLGQNWGLPPLNPHTLKETSYEAYVQLL
RANMKACGALRIDHVLGLLRLWWIPKGEDATKGAYMHYPVEDMLSILALESHRYQCSVIG
EDLGTVPDEIVDLLAEAGIHSYKVFFFETSEDGGFYSPAHYQEQSMSALCTHDMPTLRGF
WHCDDLKMGEEIGLYPDPEQLKELFNTRAESKQEILNSVDFHGYLPEGVGRDASFVPMDR
YLSDALQCHLAAGSSTLLSLQLEDWLEMDKPVNIPGTVNEYPNWRRKLSVTLDDIFNRPQ
VNELTKRLTDIRAQASQK
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagtattgtactgcccttggagaaaagcgatgaaagataataacaatgtactc
catcaagtcgcagaactggcagggttaaaaaacagctatgtaagtgcttggggcaatgaa
gcaaaagtcagtgatgaaaccttaattcgtctactggcttctttaggttatgacactaag
aatgataaaacactcttaagttctgctgaaaagaaacataaaaaagacgtactttctact
gtacaggtagttcgagataatgaactgcttcaagtagaaatgaatcttggtaaaagtgct
cgtatcagtgaatttagttggaaaatcaccactgaagagggggaagtattagaagggtac
ttacaatctcaaatcgtttcagacgagcgtgaaaatgatggtacattgttattctcttta
ccaactctgccatggggttaccataaattagaagtgattcgtaagcgtcgtaaagcacct
tatgaaatgacattaattgtgacgccaaaagcgtgtttcaaacaagatgcaatgcttaaa
ggcaaaaaaatgtgggggccaagtgttcaattatacacattaagaacaccgcataactgg
ggtattggtgactttggtgatcttaagcaactagtaggtgatattgctgttcgtggcggt
gattttgttggtttaaacccgattcattcactgtttcctgctaaccctgaaggggcgagc
ccatacagtccatcctctcgtcgttggctaaatattttatacattgatgtatgttcagtt
cctgagtttgcactgtgtaaccaagctcaagagttggttggtagtgcagaattccaacag
cgtttagcggatgctcgtcaatctcattgggtgaattactcagaagtctctgctctaaaa
atgagtgtacttccattgctatttagcgagtttaaaactcgtcatttagataagaaaagt
gcacgagcaaaagcgttcttagagtttgttgctgaaggtggcgagagcttattacatcag
gctgcatttgatgcattgcataacagcttatacagccaagataatagtatttggggctgg
cctgtattccctcatgaattgcagcactttgataataaagccgtgcaaaaatacattgca
gataatcgtgatcaagttgatttgtatatgtacttacaatgggtggcatttactcaaatt
aacgatgtacaacaattcgcagaaaataaaggtatggacgttggtttgtatcgtgatttg
gctgttggtgttgctgattcaggttctgagacgtgggctgatcacggcaacttatgtctg
gatgtgagcattggtgcgccaccagatattttaggtccattgggacaaaactggggacta
ccgcctttaaatcctcacacactaaaagaaacaagctacgaagcgtatgttcagttgcta
cgagcaaacatgaaagcgtgtggtgcacttcgaattgaccatgtattgggcttgctacgc
ttgtggtggatccctaaaggtgaagatgcaacgaaaggcgcttacatgcactatcctgta
gaagatatgctgtctattcttgcgttagaaagtcatcgttaccaatgctccgtgattggt
gaggatttgggtacagtaccagatgagattgttgatttgcttgcagaagctggcattcat
tcgtacaaagtgttcttctttgaaacgtctgaagacggtggtttctattcaccagcgcat
tatcaagagcaatcaatgtcggcattatgtacgcatgatatgccaacgttacgtggcttt
tggcattgtgatgatttaaaaatgggtgaagagatcggtttatatccagatcctgaacaa
ctaaaagaattgtttaatactcgtgcggaatcaaaacaagagattttaaacagtgtcgat
ttccatgggtatctacctgaaggtgtgggccgtgatgcttcgtttgttcctatggataga
tacttaagtgatgcgttgcaatgccatcttgcagcgggatcgagcacacttctcagttta
cagcttgaagattggctagagatggataaaccagttaacataccgggaacggtaaatgaa
tatccaaactggcgtcgtaaattgtctgttactctggacgatatttttaatcgtccgcag
gttaatgaattaaccaaacgattaaccgacatccgcgctcaagcaagccaaaaataa

DBGET integrated database retrieval system