KEGG   Vibrio fischeri ES114: VF_A0839Help
Entry
VF_A0839          CDS       T00236                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vfi  Vibrio fischeri ES114
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vfi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(946838..947764)
Genome map
AA seq 308 aa AA seqDB search
MNDLFTKKDYSLYSNAMTFMRRPLVQNPIDNDADIVVLGAPLDMATSGRPGARLGPDAIR
RASVNLAWEGKKFPWDFNVFDHTKVIDSGDLVFDTGDAEDLTVRLEAAADAILNSGKTLL
GLGGDHFITLPLLRAYGKKYGEMALIHFDAHTDTYSHGSRYDHGTMFYHAPNEGLISPEH
SVQIGIRTEYDQKDHGFNVINAMQANDMSVDAIIEQVKGIVGDKPVYLTFDIDCLDPAFA
PGTGTPVCGGLNSDKILKIIRGLQGINMVGMDVVEVSPAYDQSDITALAGATIALELLYV
WTANRLNK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttattcaccaaaaaagattattcattgtactcaaatgcaatgacatttatg
cgtcgcccattggtacaaaacccaattgataacgacgcagatattgttgtattaggtgca
ccattagatatggcaacctcaggtcgccctggtgcgcgtttaggtcctgatgcgatccgt
cgtgcatcggtaaatctagcgtgggaaggtaaaaaattcccatgggatttcaatgtattt
gatcatacaaaagtgattgattcaggtgaccttgtttttgatactggcgatgcggaagat
ttaacggtacgccttgaagcggcagctgatgcgatcctaaatagtggtaaaacactatta
ggtctaggtggtgatcactttattactctgcctttgctacgtgcttatggtaaaaaatac
ggtgaaatggcattaattcattttgatgctcatactgacacttatagtcatggtagccgc
tacgatcacggtactatgttctatcatgctccaaatgaagggcttatttcacctgagcac
tctgttcaaattggtattcgtactgagtatgaccaaaaagatcacggctttaatgtgatt
aacgcaatgcaagccaatgacatgagtgttgatgctattatcgagcaagtaaaaggcatt
gttggtgacaaaccagtatacctaacgtttgatattgattgtcttgatcctgcctttgcg
ccgggtacaggcacaccggtatgtggtggcttgaactcagataagatcttaaaaatcatc
cgtggtttgcaaggtatcaacatggttggtatggatgtggtagaagtatcacctgcgtat
gatcaaagtgatatcacggcattggctggtgcaacgattgctttagagcttttgtatgtt
tggactgcgaatcgtttaaacaaataa

DBGET integrated database retrieval system