KEGG   Vibrio fischeri ES114: VF_A1010Help
Entry
VF_A1010          CDS       T00236                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vfi  Vibrio fischeri ES114
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VF_A1010
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VF_A1010
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VF_A1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1133541..1136201)
Genome map
AA seq 886 aa AA seqDB search
MELYIMFKKTLLSTLILAGLAGCSSTSSEQSAVNQLAENLDINYTVITNQGADDGLACKE
LQAEWASCNKVNMTLTNTGEAIDSKDWTIYFHSIRLILDVENDQFKITRVTGDLHKLEPT
EKFDGFAAGEEVVIPLIAEYWQLFETDFMPGAFVTAPGAEARNIISLDTEDTGEYVDEII
GVQLKRTLADNNVVATANTRFEKNADVVEENVAGHIIPTPLKTTLTNKTVDLAKGISITA
NGIDADQLAALNQRAELLGLETAGEYPVSVSVDKKQFKDGVSGAYKLDVTEGKATVVAFD
QAGAFYGVQSLLALVSLDNSEIPTLNVEDAPRFEYRGVMVDVARNFHSKEAILATVDQMA
AYKLNKLHLHLTDDEGWRLEIPGLPELTDIGGNRCFDETETSCLLPQLGSGADSDNFGSG
YFTTEDYLEILTYAKNRNIEVIPEIDMPAHSRAAVMSMEARYARLAAEGKMEEANQYRLM
DPKDESNVTTVQFYNKQSFINPCLDSSATFVDKVITEVAAMHKAAGVPLSTWHFGGDEAK
NIKLHAGFQDINDEEKIAWKGDLDLSKQDFPFAKSPQCQSLIASGEVADFEHLPSHFAEQ
VSKIVAKQGIPHFQAWQDGLKHSEDAGAFATESVRANFWDTLYWGGGASAYEWAEKGYDV
VISNPDYVYMDFPYEVDAKERGYYWATRATDTRKMFGFAPENLPQNAETSVDRDGNGFES
AGTVTPKKPFYGLSAQLWSETVRTDEQYEYMVFPRVIAAAERAWHEASWENEYKAGVKYS
LQTNLVDKKAQLADWTKFANTMGQRELAKLERAGIDYRLPIPGAEIANGELSMNISFPGV
TLQYSVDGGKTWAEYDNANKPKVTGDVQIRSASFTGERVSRVTSVK
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggaattgtatatcatgtttaagaaaacgcttttatcaaccctaatactagctggccta
gcaggctgttcatcaacatcatctgagcagtcagcggttaatcaactagctgaaaaccta
gatattaactacacagttattacaaaccaaggtgctgatgacggtcttgcatgtaaagag
cttcaagctgaatgggcatcatgtaacaaagtaaacatgacgttaactaatacaggtgaa
gctattgattcaaaagattggacaatttatttccacagcatccgtttaattttagatgtt
gaaaacgaccaatttaaaattactcgcgtaacgggtgatttgcataaacttgaaccaact
gaaaagtttgatggttttgcggcaggtgaagaagtggttattccactgatcgctgaatac
tggcaattatttgaaactgactttatgccgggtgcatttgtaacggctccaggtgcagaa
gctcgtaatatcatttctttagatacagaagatacaggcgaatacgtagatgaaatcatc
ggtgttcaactaaaacgtactcttgctgataataacgttgtagcaacagcaaacacacgt
tttgagaagaacgccgatgttgttgaagagaatgtggcaggtcacattattccaacacca
ttaaaaacaacactaacgaacaaaacggtagatttagctaaaggtatctctattactgca
aacggaattgatgctgaccaacttgcagcgttaaatcaacgtgcagaactacttggcctt
gaaactgcgggtgagtacccagtatcagtttctgttgataagaaacaatttaaagacggt
gtatctggtgcatacaaactagatgtgactgaaggtaaagcaacggttgtagcatttgac
caagcgggcgcattctacggcgtacaatctttacttgctctagtaagtttagataactca
gaaatcccaacgttaaacgtagaagatgctccacgttttgaataccgtggtgtaatggtt
gacgtagctcgtaacttccactcaaaagaagcgattctagcaactgttgatcaaatggcg
gcatacaagctgaacaaactacaccttcacttaactgatgatgaaggttggcgtttagag
atccctggtcttcctgagctaacggatattggtggtaatcgttgttttgatgagacagaa
acctcttgtctattacctcaactaggttctggtgctgattcagataactttggttctggc
tacttcacaacagaagattacctagaaatcttaacttacgcgaaaaaccgtaacattgaa
gtgattccagaaatcgatatgccagcccactcacgtgcagcagttatgtcaatggaagcg
cgttacgcacgtcttgctgctgaaggtaagatggaagaagcgaatcaataccgtctgatg
gatccaaaagatgaatcaaacgtaactacggttcagttctacaacaaacaaagttttatc
aacccatgtctagattcatctgcaacgtttgtagataaagtaatcacagaagttgcagca
atgcataaagcggcaggtgttcctctatcaacatggcacttcggtggtgatgaagcgaaa
aacatcaaacttcacgctggtttccaagacatcaacgatgaagagaaaattgcatggaaa
ggagatttagatctatctaaacaagatttcccatttgcaaaatcgccacagtgtcagtct
ctgatcgcaagcggtgaagttgctgatttcgaacatttaccaagccacttcgcagagcaa
gtatctaagatcgttgctaagcaaggtatcccacacttccaagcatggcaagatggccta
aaacactctgaagatgcaggcgcattcgcaacggaatcagtacgtgctaacttctgggac
acattgtactggggcggtggtgcttcagcttacgaatgggctgaaaaaggttacgacgta
gttatctctaacccagattacgtttacatggacttcccatacgaagtggatgcaaaagag
cgtggttactactgggcaacacgtgcaacagacactcgtaagatgtttggttttgcacca
gaaaacctacctcaaaatgcggaaacatcagtagaccgtgacggtaatggctttgaaagt
gcgggtacagtaacacctaagaaacctttctacggtctatctgctcaactttggtctgaa
acagtacgtactgatgagcaatatgaatacatggtgttcccacgtgttattgcagcggct
gagcgtgcatggcatgaagcatcttgggaaaatgaatacaaagcaggtgttaagtactct
ctacaaacaaacctagtagataagaaagcacaattagctgattggactaagtttgcaaac
acaatgggtcaacgtgaattagctaagcttgaaagagcgggcattgattaccgtctacca
atcccaggtgcagaaattgcgaacggtgagctaagcatgaacatttcattcccaggcgta
acgctacaatactctgtagatggcggtaaaacatgggctgaatacgacaatgcaaacaaa
ccaaaagtaactggtgacgttcaaattcgttcagcatcatttactggtgagcgtgttagc
cgtgtaactagcgttaagtaa

DBGET integrated database retrieval system