KEGG   Vibrio fischeri ES114: VF_A1044Help
Entry
VF_A1044          CDS       T00236                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vfi  Vibrio fischeri ES114
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vfi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1179169..1179783
Genome map
AA seq 204 aa AA seqDB search
MRRLLTFILILISSQLLTVKTAYSQTLLILGDSLSAGYNMPIEQSWPSLLPEQLNALGKP
TTVINGSISGDTTGNGLDRLPNLLEQHKPNYVLIELGANDGLRGFPPQKINANLEKIFAQ
IKAINAQPLLMQIQVPPNYGKRYSQAFGSLYPKLSEKHAIPLLPFFLEQVIVKPEWMMKD
GLHPKPEAQPWIAEFMAKELQPYL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagattactgacttttattctgatacttattagcagccagctacttactgtaaaa
actgcttatagccaaacgttactgattcttggtgacagcttgagtgcaggttataacatg
ccaatagaacaaagttggccttcactattaccagagcaactcaatgctttaggtaagcca
accacagttataaatggcagtatttcaggcgatacaacaggtaatgggctagatcgacta
cctaatctattagaacaacataaacctaattatgttcttattgagttaggtgccaatgat
ggactgcgtggatttccaccacagaagattaatgctaatttagaaaagatattcgctcaa
attaaggcgattaatgcacaaccattattgatgcaaattcaagtaccacctaactatgga
aaacgatacagccaagcgtttggatcactttaccctaaattaagtgaaaaacacgccatc
cctctattaccttttttcttagaacaagtaattgtaaaaccagaatggatgatgaaagat
ggattgcacccaaagccagaagctcaaccttggatagcggagtttatggcaaaagagctg
caaccctatttataa

DBGET integrated database retrieval system