KEGG   Aiivibrio fischeri MJ11: VFMJ11_0063Help
Entry
VFMJ11_0063       CDS       T00754                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00860  Porphyrin and chlorophyll metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
Module
vfm_M00121  Heme biosynthesis, glutamate => heme
vfm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VFMJ11_0063 (hemD)
Enzymes [BR:vfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VFMJ11_0063 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF5335
Motif
Other DBs
NCBI-ProteinID: ACH64973
UniProt: B5FF96
Position
I:complement(69640..70401)
Genome map
AA seq 253 aa AA seqDB search
MTILVTRPEQESQALCDALNQSGHPAISHPLITIHPGNELSQLPRLFSSLNDGDFIIAVS
QHAVEYTQKYLKQLQLEWKQGVNYIAVGQKSAQHLKKYISDPVHYPTHSDSEHLLALPVL
QNATGKKAIILRGNGGRDLIYQVLNDLNVDVTYCEAYQRQAIAFDASIKTREWQEKNVNT
LIVTSGEQLSFFTSQFISTDLNWVLKLRLLVPSERINQFAKELGYQHIETVGGASNSDLL
HYICEHHYDGIFK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttggtgactcgccctgagcaagagagccaagctttatgtgatgccttgaat
caatcagggcatccagctatttctcatcctcttatcaccattcaccccggcaatgaactg
tctcaactccctaggctattttcttcacttaatgatggtgattttattatcgctgtcagt
cagcacgctgttgaatacacccaaaagtatttaaaacagctacaattagagtggaaacag
ggggttaattatattgcggtcggtcaaaagagcgctcaacacctcaaaaagtatatttca
gatccagtacactacccaacccatagcgacagtgaacatttattagctcttcctgtctta
caaaacgcgacagggaaaaaagccattattcttcgaggaaatggcggacgagatctgatt
tatcaagttctgaacgatctcaatgtggatgtgacatattgcgaggcttaccaacgtcaa
gccatcgcatttgatgcatctatcaaaactcgagagtggcaagaaaagaacgtaaacaca
ttgattgtgaccagtggtgaacaactctcttttttcacctctcaatttataagtacagat
ttaaattgggtactgaagcttagattattggtaccaagtgagcgcattaaccagtttgca
aaagaacttggttatcaacatattgaaacggttggcggagcctctaattccgacttgctg
cactatatctgtgagcatcattatgatgggattttcaaatga

DBGET integrated database retrieval system