KEGG   Aiivibrio fischeri MJ11: VFMJ11_0104Help
Entry
VFMJ11_0104       CDS       T00754                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00230  Purine metabolism
vfm01100  Metabolic pathways
Module
vfm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VFMJ11_0104 (gmk)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VFMJ11_0104 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase ABC_tran AAA_18 MMR_HSR1 AAA_22 CPT cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ACH64927
UniProt: B5FFD7
Position
I:complement(121406..122029)
Genome map
AA seq 207 aa AA seqDB search
MSKGTLYIVSAPSGAGKSSLISALLESNPTYAMKVSVSHTTRGMRPGETDGVHYHFIQKE
HFEELIQKGEFLEYAEVFGNYYGTSRVWIEETLDKGIDVFLDIDWQGARQIREQMPLAKS
VFILPPSNGELERRLNARGQDSDAVIAKRMSEAKSEISHYDEYDYVIINDDFDTAQMDFR
SIIRAERLKQDKQTMKYKGMLEALLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggtacactttatattgtgtcagccccaagtggtgctggtaagtcgagtttg
atctcggcactgttagaaagcaacccaacttatgctatgaaagtctctgtgtctcatact
actcgtggtatgcgcccaggagaaactgatggtgttcattatcactttattcagaaagag
cattttgaagaactgattcaaaaaggtgaattcttagaatatgccgaagtgtttggtaac
tactacggaacatctcgtgtatggatcgaagagacccttgataaaggtattgatgtgttc
ttagatattgactggcaaggtgctcgtcaaatccgtgaacaaatgcctttagcaaaaagc
gtattcattctacctccatcaaatggagaactagaacgacgcctaaatgcacgtggccaa
gacagcgatgctgttattgctaagcgcatgagcgaagcaaaatctgaaatttcacattac
gatgaatacgattatgtgatcattaatgacgattttgatactgcacaaatggacttccgt
tcaattatccgtgcagaacgcttaaaacaagacaaacaaacaatgaaatataaaggcatg
ttagaagcgctattagcggactaa

DBGET integrated database retrieval system