KEGG   Aiivibrio fischeri MJ11: VFMJ11_0128Help
Entry
VFMJ11_0128       CDS       T00754                                 

Gene name
mutM
Definition
(GenBank) formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    VFMJ11_0128 (mutM)
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     VFMJ11_0128 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     VFMJ11_0128 (mutM)
DNA repair and recombination proteins [BR:vfm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VFMJ11_0128 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:146038..146859
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETSRLGITPHLQGQTIKAIVVRTDKLRWPIPQELQKLVGQRVQSIRRRAKYLM
IDTPEGSAIIHLGMSGSLRVLDEEVPSAKHDHVDLVLENGKVLRYNDPRKFGAWLYSEVG
VAHQVLSKLGPEPLTNEFNSEYFAEKAKNKKTVVKQFIMNNAVVVGVGNIYASESLFMAQ
IHPKTPVGSLKASQITVLVAEIKKVLETAIKQGGTTLKDFNQVDGKPGYFAQELKVYGRA
GKECPVCSSKIEEEKIGQRNSFWCGKCQFLAED
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattgccagaagtagaaaccagccgcctaggaattaccccacatctgcaaggt
cagacaattaaagccattgtggttagaacggataagcttcgttggccaattcctcaagaa
ttgcaaaaattagttggacaaagagttcagtcaattcgtcgccgtgcaaaatatttaatg
atagataccccagaaggcagtgcgattattcatttaggaatgtcgggcagtttacgtgtt
ttagatgaagaagtgccgtcagcaaaacacgatcatgttgatctagttttagagaatggc
aaagttcttcgttataacgatccacgcaagtttggcgcttggttatattctgaggtaggt
gtagcgcatcaagtactttctaagctaggaccagaaccactaacaaatgaatttaatagc
gagtattttgctgagaaagccaagaataaaaaaacagtagtgaaacaatttataatgaac
aatgctgtagtggttggcgttggtaatatttatgccagtgaatccttgtttatggctcaa
attcatcctaaaacaccagtaggttcattaaaagcgtctcagattactgttcttgtggct
gaaataaaaaaagtgctagaaaccgcaattaagcaaggtggaacaacactaaaagatttt
aatcaagttgatggcaaacctggatattttgcacaggaattgaaagtgtatgggagagca
gggaaagagtgcccagtttgctctagtaaaatagaagaagagaaaattgggcaacggaat
agtttttggtgcggaaagtgtcagtttttagctgaagattga

DBGET integrated database retrieval system