KEGG   Vibrio fischeri MJ11: VFMJ11_0160Help
Entry
VFMJ11_0160       CDS       T00754                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:vfm00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:vfm00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:177893..178462
Genome map
AA seq 189 aa AA seqDB search
MKVTDTRIPDVKIIEPSVFGDERGFFMETWNQKQFEELVTGKLTQFVQDNHSKSKKGILR
GLHYQTENTQGKLVRVISGEVFDVAVDIRKGSPTFGQWIGEYLSAENKRQLWIPEGFAHG
FYVTSEEAEFVYKCTDYYNPTAEVSIKWDDPTVNIEWPLKMLPSLSNKDKKAKMFNDVIK
EIYGDNNAN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccgatacccgaatccctgatgtaaaaattatagaaccaagtgtgtttggt
gatgagcgaggtttctttatggaaacctggaatcaaaagcagtttgaagagttggtaaca
ggtaagctcacccaatttgtacaagataatcattccaaatctaagaaaggaattttacga
ggattgcattaccaaacagaaaacactcaggggaaattagttcgagtgatttctggtgaa
gtgtttgatgttgcagttgatattcgaaaaggctcaccgacgtttggtcaatggataggt
gaatatttatcggctgaaaacaagcgtcaactttggataccggaaggttttgcgcatggt
ttttatgtgacgagtgaagaagcagagttcgtatataagtgtacggattattacaatccg
acagctgaagtatcaattaagtgggatgaccctacagtaaatatagagtggccgttaaaa
atgcttccttctctgtcaaacaaagataagaaagcaaaaatgtttaatgacgttataaaa
gaaatttatggagataacaatgctaattga

DBGET integrated database retrieval system