KEGG   Aiivibrio fischeri MJ11: VFMJ11_0197Help
Entry
VFMJ11_0197       CDS       T00754                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VFMJ11_0197 (tpiA)
   01230 Biosynthesis of amino acids
    VFMJ11_0197 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_0197 (tpiA)
   00051 Fructose and mannose metabolism
    VFMJ11_0197 (tpiA)
   00562 Inositol phosphate metabolism
    VFMJ11_0197 (tpiA)
Enzymes [BR:vfm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VFMJ11_0197 (tpiA)
Exosome [BR:vfm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VFMJ11_0197 (tpiA)
  Exosomal proteins of bladder cancer cells
   VFMJ11_0197 (tpiA)
  Exosomal proteins of melanoma cells
   VFMJ11_0197 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(219643..220413)
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVELLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA
IILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLTPVLCIGESEAQNEAGETVAVCARQIDAVINTQGVDALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAEAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaactaaacggcagcaaagaaatggttgtt
gaactactaaacggtcttaacgctgaacttgaaggcgttacaggcgtagacgtagcagtt
gctccacctgcactatttgtagaccttgctgagcgtacgcttactgaagctggtagcgca
atcatcctaggtgctcaaaacactgatctaaacaacagcggtgcattcactggcgacatg
tctccagctatgcttaaagagttcggtgcaactcacatcatcatcggtcactctgagcgt
cgtgaataccacaacgaatcagacgagttcgttgctaagaaattcgctttcctaaaagaa
aacggtcttactcctgttctttgtatcggtgaatctgaagctcaaaacgaagctggtgaa
actgttgcagtatgtgcacgtcaaatcgacgcagttatcaacactcaaggcgttgacgct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagct
acagctgaagatgcacaacgcatccacgctcaaatccgtgctcacattgctgagaaatct
gaagaagttgctaagaacgttgttatccaatacggcggttctgttaagcctgaaaacgct
gcagcttacttcgcacaaccagacatcgatggtgctctagttggcggtgcagctcttgac
gcgaaaagctttgcagctatcgctaaagcagcagctgaagcaaaagcttaa

DBGET integrated database retrieval system