KEGG   Aiivibrio fischeri MJ11: VFMJ11_0197Help
Entry
VFMJ11_0197       CDS       T00754                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00010  Glycolysis / Gluconeogenesis
vfm00051  Fructose and mannose metabolism
vfm00562  Inositol phosphate metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm01130  Biosynthesis of antibiotics
vfm01200  Carbon metabolism
vfm01230  Biosynthesis of amino acids
Module
vfm_M00002  Glycolysis, core module involving three-carbon compounds
vfm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_0197 (tpiA)
   00051 Fructose and mannose metabolism
    VFMJ11_0197 (tpiA)
   00562 Inositol phosphate metabolism
    VFMJ11_0197 (tpiA)
Enzymes [BR:vfm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VFMJ11_0197 (tpiA)
Exosome [BR:vfm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VFMJ11_0197 (tpiA)
  Exosomal proteins of bladder cancer cells
   VFMJ11_0197 (tpiA)
  Exosomal proteins of melanoma cells
   VFMJ11_0197 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACH65066
UniProt: B5FFY1
Position
I:complement(219643..220413)
Genome map
AA seq 256 aa AA seqDB search
MRHPVVMGNWKLNGSKEMVVELLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA
IILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVAKKFAFLKE
NGLTPVLCIGESEAQNEAGETVAVCARQIDAVINTQGVDALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD
AKSFAAIAKAAAEAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcctgtagttatgggtaactggaaactaaacggcagcaaagaaatggttgtt
gaactactaaacggtcttaacgctgaacttgaaggcgttacaggcgtagacgtagcagtt
gctccacctgcactatttgtagaccttgctgagcgtacgcttactgaagctggtagcgca
atcatcctaggtgctcaaaacactgatctaaacaacagcggtgcattcactggcgacatg
tctccagctatgcttaaagagttcggtgcaactcacatcatcatcggtcactctgagcgt
cgtgaataccacaacgaatcagacgagttcgttgctaagaaattcgctttcctaaaagaa
aacggtcttactcctgttctttgtatcggtgaatctgaagctcaaaacgaagctggtgaa
actgttgcagtatgtgcacgtcaaatcgacgcagttatcaacactcaaggcgttgacgct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagct
acagctgaagatgcacaacgcatccacgctcaaatccgtgctcacattgctgagaaatct
gaagaagttgctaagaacgttgttatccaatacggcggttctgttaagcctgaaaacgct
gcagcttacttcgcacaaccagacatcgatggtgctctagttggcggtgcagctcttgac
gcgaaaagctttgcagctatcgctaaagcagcagctgaagcaaaagcttaa

DBGET integrated database retrieval system