KEGG   Aiivibrio fischeri MJ11: VFMJ11_0333Help
Entry
VFMJ11_0333       CDS       T00754                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00040  Pentose and glucuronate interconversions
vfm00052  Galactose metabolism
vfm00500  Starch and sucrose metabolism
vfm00520  Amino sugar and nucleotide sugar metabolism
vfm01100  Metabolic pathways
vfm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VFMJ11_0333 (galU)
   00052 Galactose metabolism
    VFMJ11_0333 (galU)
   00500 Starch and sucrose metabolism
    VFMJ11_0333 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VFMJ11_0333 (galU)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VFMJ11_0333 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 SAP30_Sin3_bdg
Motif
Other DBs
NCBI-ProteinID: ACH66424
UniProt: B5FGL9
Position
I:complement(360368..361237)
Genome map
AA seq 289 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAINAGMDGMCIVTGRGKH
SLMDHFDKNYELEHQISGTNKEELLEDVRELIDSAHFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVEEVPDNETHKYGVISGEMIKDD
LYRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAQSG
CVLAYKFKGKRFDCGSVEGYIEATNHCYENIYLKDKKSSELAKKVTGKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgtttatttcctgccgcaggctacggcacacgctttttaccagcaaca
aaatcaatgccaaaagaaatgatgcctgttgtaaacaagcctcttattgaatacggtgtt
gaagaagcaatcaatgctggtatggacggtatgtgtattgttactggtcgtggtaaacat
tctttaatggatcactttgataaaaactacgaattagaacaccaaatcagtggtacaaac
aaagaagaacttcttgaagatgttcgtgaactgattgattcagctcatttcacttatatt
cgtcaacgtgaaatgaaaggcttaggtcatgcaattttaaccggtcgtgaacttgtaggt
gatgaacctttcgcagttgtacttgctgatgacttatgtgtgaacgaagagcaaggcgta
ttggctcaaatggttgctttatacaagcaattccgttgttctatcgttgctgtagaagaa
gtaccagacaacgaaacacataaatacggtgtgatttctggtgaaatgatcaaagatgat
ttataccgtgttgataacatggtagaaaagccagagccaggaacagcaccaagcaaccta
gctattattggtcgttacatcctaactcctgatatttttgaattaatcgagcaaacagaa
ccaggtaaaggcggtgaaattcaaatcaccgatgctctactaaaacaagcacaatcaggc
tgtgttttagcttataaatttaaaggtaagcgttttgactgtggcagcgttgaaggttat
atcgaagcaacgaaccactgttatgaaaacatttatctaaaagataaaaaatcatcagaa
ttagcaaaaaaagtaacgggtaaaaaataa

DBGET integrated database retrieval system