KEGG   Vibrio fischeri MJ11: VFMJ11_0333Help
Entry
VFMJ11_0333       CDS       T00754                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VFMJ11_0333 (galU)
   00052 Galactose metabolism
    VFMJ11_0333 (galU)
   00500 Starch and sucrose metabolism
    VFMJ11_0333 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VFMJ11_0333 (galU)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VFMJ11_0333 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(360368..361237)
Genome map
AA seq 289 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAINAGMDGMCIVTGRGKH
SLMDHFDKNYELEHQISGTNKEELLEDVRELIDSAHFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVEEVPDNETHKYGVISGEMIKDD
LYRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAQSG
CVLAYKFKGKRFDCGSVEGYIEATNHCYENIYLKDKKSSELAKKVTGKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgtttatttcctgccgcaggctacggcacacgctttttaccagcaaca
aaatcaatgccaaaagaaatgatgcctgttgtaaacaagcctcttattgaatacggtgtt
gaagaagcaatcaatgctggtatggacggtatgtgtattgttactggtcgtggtaaacat
tctttaatggatcactttgataaaaactacgaattagaacaccaaatcagtggtacaaac
aaagaagaacttcttgaagatgttcgtgaactgattgattcagctcatttcacttatatt
cgtcaacgtgaaatgaaaggcttaggtcatgcaattttaaccggtcgtgaacttgtaggt
gatgaacctttcgcagttgtacttgctgatgacttatgtgtgaacgaagagcaaggcgta
ttggctcaaatggttgctttatacaagcaattccgttgttctatcgttgctgtagaagaa
gtaccagacaacgaaacacataaatacggtgtgatttctggtgaaatgatcaaagatgat
ttataccgtgttgataacatggtagaaaagccagagccaggaacagcaccaagcaaccta
gctattattggtcgttacatcctaactcctgatatttttgaattaatcgagcaaacagaa
ccaggtaaaggcggtgaaattcaaatcaccgatgctctactaaaacaagcacaatcaggc
tgtgttttagcttataaatttaaaggtaagcgttttgactgtggcagcgttgaaggttat
atcgaagcaacgaaccactgttatgaaaacatttatctaaaagataaaaaatcatcagaa
ttagcaaaaaaagtaacgggtaaaaaataa

DBGET integrated database retrieval system