KEGG   Vibrio fischeri MJ11: VFMJ11_0391Help
Entry
VFMJ11_0391       CDS       T00754                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vfm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vfm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:419382..420650
Genome map
AA seq 422 aa AA seqDB search
MYKFRIQGSDKPLSGEVTISGAKNAALPILFASLLAEEPVEVANVPKLRDVDTTMELLKR
LGAEVSRNGSVHIDASGVNDFCAPYDLVKTMRASIWALGPLVARFGKGQVSLPGGCAIGA
RPVDLHIHGLEQLGATIKLEEGYVKAEVDGRLKGAHIVMDKVSVGATITVMCAATLAEGT
TVLENAAREPEIVDTANFLNAIGAKVSGMGTDTITIEGVERLGGGYHEVVADRIETGTFL
VAAAVSGGKIVCKNTKAHLLEAVLAKLEEAGADVQTGDDWISLDMTGRELKAVNIRTAPH
PAFPTDMQAQFTLLNMMAKGSGIITETIFENRFMHIPELQRMGAHAEIEGNTAICGDTDG
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYDKIEDKLTALGANIERVHSD
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtataagtttcgaattcaaggaagtgataaaccactttctggcgaagttacaatttct
ggtgcaaaaaatgctgcactaccaattctatttgcttcgttgcttgcagaagaacctgtt
gaagtagcaaatgtaccgaaacttcgtgatgttgataccacgatggaactgttaaagcgt
ttaggtgctgaagtatctcgtaacggttctgttcatattgatgcaagtggcgtaaatgac
ttctgtgcaccttatgatttagttaaaacaatgcgtgcatcaatttgggcattaggtcca
ttggttgctcgttttggtaaaggtcaggtttcattacctggtggttgtgctatcggcgct
cgtcctgttgatcttcatattcacggattagagcaactaggcgcaacaatcaaacttgaa
gaaggttatgtaaaagcggaagttgatggtcgccttaaaggtgctcatatcgtaatggac
aaagtcagtgttggtgcaaccattactgttatgtgtgcagcaacattagctgaaggcacg
acggtattagaaaacgcagcgcgtgaacctgaaattgttgatactgctaatttccttaat
gctatcggcgctaaagtgtctggtatgggtaccgatacaattactatcgaaggtgttgag
cgcttaggtggtggttatcacgaagtggttgctgaccgtatagaaacaggtacgttcctt
gttgctgctgcggtatctggcggtaagatcgtttgtaagaatacaaaagcacatctactt
gaagcggtacttgctaaacttgaagaagcgggtgcagacgttcaaactggtgatgattgg
attagcttagatatgactggccgtgagttaaaggcggtaaatatccgtactgcaccacac
ccagcattccctaccgatatgcaagctcaattcacacttttaaatatgatggccaaaggt
tcaggtatcattactgaaacgattttcgaaaaccgtttcatgcacattcctgaattgcaa
cgtatgggtgctcatgctgaaatcgaaggtaatactgctatttgtggtgatactgatggt
ttaagtggtgctcaggttatggcgacagatttacgtgcatcagcaagccttgtgatcgca
ggttgtatagcaaaaggtgaaacaattgttgatcgaatttatcatatcgaccgtggatat
gataagattgaagacaagttaaccgctttaggtgcaaatattgagcgagttcatagcgac
gacttataa

DBGET integrated database retrieval system