KEGG   Aiivibrio fischeri MJ11: VFMJ11_0391Help
Entry
VFMJ11_0391       CDS       T00754                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VFMJ11_0391 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VFMJ11_0391 (murA)
Enzymes [BR:vfm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     VFMJ11_0391 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:419382..420650
Genome map
AA seq 422 aa AA seqDB search
MYKFRIQGSDKPLSGEVTISGAKNAALPILFASLLAEEPVEVANVPKLRDVDTTMELLKR
LGAEVSRNGSVHIDASGVNDFCAPYDLVKTMRASIWALGPLVARFGKGQVSLPGGCAIGA
RPVDLHIHGLEQLGATIKLEEGYVKAEVDGRLKGAHIVMDKVSVGATITVMCAATLAEGT
TVLENAAREPEIVDTANFLNAIGAKVSGMGTDTITIEGVERLGGGYHEVVADRIETGTFL
VAAAVSGGKIVCKNTKAHLLEAVLAKLEEAGADVQTGDDWISLDMTGRELKAVNIRTAPH
PAFPTDMQAQFTLLNMMAKGSGIITETIFENRFMHIPELQRMGAHAEIEGNTAICGDTDG
LSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRGYDKIEDKLTALGANIERVHSD
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtataagtttcgaattcaaggaagtgataaaccactttctggcgaagttacaatttct
ggtgcaaaaaatgctgcactaccaattctatttgcttcgttgcttgcagaagaacctgtt
gaagtagcaaatgtaccgaaacttcgtgatgttgataccacgatggaactgttaaagcgt
ttaggtgctgaagtatctcgtaacggttctgttcatattgatgcaagtggcgtaaatgac
ttctgtgcaccttatgatttagttaaaacaatgcgtgcatcaatttgggcattaggtcca
ttggttgctcgttttggtaaaggtcaggtttcattacctggtggttgtgctatcggcgct
cgtcctgttgatcttcatattcacggattagagcaactaggcgcaacaatcaaacttgaa
gaaggttatgtaaaagcggaagttgatggtcgccttaaaggtgctcatatcgtaatggac
aaagtcagtgttggtgcaaccattactgttatgtgtgcagcaacattagctgaaggcacg
acggtattagaaaacgcagcgcgtgaacctgaaattgttgatactgctaatttccttaat
gctatcggcgctaaagtgtctggtatgggtaccgatacaattactatcgaaggtgttgag
cgcttaggtggtggttatcacgaagtggttgctgaccgtatagaaacaggtacgttcctt
gttgctgctgcggtatctggcggtaagatcgtttgtaagaatacaaaagcacatctactt
gaagcggtacttgctaaacttgaagaagcgggtgcagacgttcaaactggtgatgattgg
attagcttagatatgactggccgtgagttaaaggcggtaaatatccgtactgcaccacac
ccagcattccctaccgatatgcaagctcaattcacacttttaaatatgatggccaaaggt
tcaggtatcattactgaaacgattttcgaaaaccgtttcatgcacattcctgaattgcaa
cgtatgggtgctcatgctgaaatcgaaggtaatactgctatttgtggtgatactgatggt
ttaagtggtgctcaggttatggcgacagatttacgtgcatcagcaagccttgtgatcgca
ggttgtatagcaaaaggtgaaacaattgttgatcgaatttatcatatcgaccgtggatat
gataagattgaagacaagttaaccgctttaggtgcaaatattgagcgagttcatagcgac
gacttataa

DBGET integrated database retrieval system