KEGG   Aiivibrio fischeri MJ11: VFMJ11_0402Help
Entry
VFMJ11_0402       CDS       T00754                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00230  Purine metabolism
vfm00240  Pyrimidine metabolism
vfm01100  Metabolic pathways
vfm03030  DNA replication
vfm03430  Mismatch repair
vfm03440  Homologous recombination
Module
vfm_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VFMJ11_0402
   00240 Pyrimidine metabolism
    VFMJ11_0402
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VFMJ11_0402
   03430 Mismatch repair
    VFMJ11_0402
   03440 Homologous recombination
    VFMJ11_0402
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VFMJ11_0402
DNA replication proteins [BR:vfm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VFMJ11_0402
DNA repair and recombination proteins [BR:vfm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     VFMJ11_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi Pico_P2A
Motif
Other DBs
NCBI-ProteinID: ACH66974
UniProt: B5F9Q5
Position
I:complement(431450..431893)
Genome map
AA seq 147 aa AA seqDB search
MSQALFYVLEPTSPAATTDGQLKFVCQLAHYYYSQNARVYVLAQDKEQALLIDEALWQYD
VSEFTPHNLVGEGPKSGSPIEIGWGTLRSSGRRHVLINLAQEVASFAVSFAQVVDFVPCE
EKSKQQARERYKIYRNAGRAMQTEILK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccctgttttatgttttagaacccacatctccagctgcaaccactgatggt
cagctaaaatttgtgtgtcagcttgctcactattattactctcaaaatgcacgagtgtat
gtattagcccaagataaagaacaagccttgctgattgatgaagcactttggcaatatgat
gtatcagaatttacgccacacaatttagttggagaagggccaaaatcaggctcccctatc
gaaattggttggggaacattacgctcatcaggacgccgtcatgtgttaattaatttagct
caagaggtcgcaagttttgctgtttcctttgctcaagtggtagacttcgtaccttgcgaa
gaaaaaagcaaacaacaagctcgagaaaggtataaaatataccgaaatgcaggccgagcc
atgcaaaccgagatactgaaatga

DBGET integrated database retrieval system