KEGG   Vibrio fischeri MJ11: VFMJ11_0449Help
Entry
VFMJ11_0449       CDS       T00754                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vfm  Vibrio fischeri MJ11
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:467753..468529
Genome map
AA seq 258 aa AA seqDB search
MSFIRRTSAMIIALMSVVSFTACSDEQAQKQDALPSAVETAQPDSEQAITQRLTTLGLPV
EAIHDSEVDGFKQVETPFGIFYVSSDGKHFIQGRIFEFDENGNMKDLLAARFAKLVDSQS
DNMIVFPAKNEKHVITVFTDITCGYCTKLHKEMKDYNDAGITVRYLAYPRQGYQGSVADK
MAQIWCADDKQQAMEDAKSNRPINGSKPATAECKNIIKEQYLLGRKMGVNGTPAIVLPSG
DLVPGYKPARELLSDLER
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttattcgccgaactagtgcgatgattattgctttaatgagcgtagtttctttt
actgcatgttcagatgaacaagcacaaaaacaggatgcattaccttctgcagttgagact
gctcaacctgattcagaacaagctattactcagcgactaacgactttaggtttgcctgta
gaagctattcatgattcagaagttgacggctttaaacaagttgaaactccgtttggtatt
ttttacgtatcttctgatggtaagcatttcatccaaggtagaatttttgagtttgatgaa
aacggcaacatgaaagatttattagccgcgcgttttgctaaattggtggatagccaaagc
gataatatgattgtgttccctgctaaaaatgaaaaacacgtaattaccgtttttacagac
atcacttgtggctactgtacaaaactgcataaagagatgaaagactataatgatgcgggt
attaccgttcgttatttagcatatcctcgtcaaggctaccaaggttcagtagctgataaa
atggcccaaatttggtgtgctgatgataaacagcaagcgatggaagatgcaaaatcaaat
cgtccaattaatggttcaaaaccagcaacggctgagtgtaaaaatatcattaaagaacaa
tacttattgggtagaaaaatgggtgtaaatggaactcctgcaattgttcttccaagtggt
gatcttgttcctggatataaaccagctcgtgagcttctatctgatttagaaagataa

DBGET integrated database retrieval system