KEGG   Aiivibrio fischeri MJ11: VFMJ11_0449Help
Entry
VFMJ11_0449       CDS       T00754                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vfm  Aiivibrio fischeri MJ11
Brite
Enzymes [BR:vfm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VFMJ11_0449
Secretion system [BR:vfm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VFMJ11_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:467753..468529
Genome map
AA seq 258 aa AA seqDB search
MSFIRRTSAMIIALMSVVSFTACSDEQAQKQDALPSAVETAQPDSEQAITQRLTTLGLPV
EAIHDSEVDGFKQVETPFGIFYVSSDGKHFIQGRIFEFDENGNMKDLLAARFAKLVDSQS
DNMIVFPAKNEKHVITVFTDITCGYCTKLHKEMKDYNDAGITVRYLAYPRQGYQGSVADK
MAQIWCADDKQQAMEDAKSNRPINGSKPATAECKNIIKEQYLLGRKMGVNGTPAIVLPSG
DLVPGYKPARELLSDLER
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttattcgccgaactagtgcgatgattattgctttaatgagcgtagtttctttt
actgcatgttcagatgaacaagcacaaaaacaggatgcattaccttctgcagttgagact
gctcaacctgattcagaacaagctattactcagcgactaacgactttaggtttgcctgta
gaagctattcatgattcagaagttgacggctttaaacaagttgaaactccgtttggtatt
ttttacgtatcttctgatggtaagcatttcatccaaggtagaatttttgagtttgatgaa
aacggcaacatgaaagatttattagccgcgcgttttgctaaattggtggatagccaaagc
gataatatgattgtgttccctgctaaaaatgaaaaacacgtaattaccgtttttacagac
atcacttgtggctactgtacaaaactgcataaagagatgaaagactataatgatgcgggt
attaccgttcgttatttagcatatcctcgtcaaggctaccaaggttcagtagctgataaa
atggcccaaatttggtgtgctgatgataaacagcaagcgatggaagatgcaaaatcaaat
cgtccaattaatggttcaaaaccagcaacggctgagtgtaaaaatatcattaaagaacaa
tacttattgggtagaaaaatgggtgtaaatggaactcctgcaattgttcttccaagtggt
gatcttgttcctggatataaaccagctcgtgagcttctatctgatttagaaagataa

DBGET integrated database retrieval system