KEGG   Aiivibrio fischeri MJ11: VFMJ11_0499Help
Entry
VFMJ11_0499       CDS       T00754                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VFMJ11_0499
   00240 Pyrimidine metabolism
    VFMJ11_0499
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VFMJ11_0499
   03430 Mismatch repair
    VFMJ11_0499
   03440 Homologous recombination
    VFMJ11_0499
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VFMJ11_0499
DNA replication proteins [BR:vfm03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VFMJ11_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:524937..525338
Genome map
AA seq 133 aa AA seqDB search
MPQQALQFLNEMDISVWQVRQTSYFPALENTTLSLPETCQLLFVAPAIPTERDAFLFGKV
LASMKLSPEQALFLSSESLEYIGEHHLDWCWFSGVSTTELEGVKILTSPLLSEMHSNTQS
RRDLWRQICSYDN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgccccaacaagcactacagtttttaaatgagatggatatttcggtttggcaggttcgt
cagacaagctattttccagcattagaaaacacaacattatcgttacctgaaacttgtcag
ttattatttgtagctcctgctataccgacagaacgtgatgcttttctatttggaaaagtg
cttgcgagtatgaagctgtcgcctgagcaggcgttatttctttcctctgagtcattagaa
tatattggtgagcatcatttagattggtgctggttctctggtgtatcaaccacagagcta
gaaggcgttaaaatattaacctctcctttattgtcagagatgcattctaatactcaatca
cgacgtgatttatggcgacaaatttgttcttatgacaattaa

DBGET integrated database retrieval system