KEGG   Vibrio fischeri MJ11: VFMJ11_0499Help
Entry
VFMJ11_0499       CDS       T00754                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vfm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vfm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vfm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vfm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vfm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:524937..525338
Genome map
AA seq 133 aa AA seqDB search
MPQQALQFLNEMDISVWQVRQTSYFPALENTTLSLPETCQLLFVAPAIPTERDAFLFGKV
LASMKLSPEQALFLSSESLEYIGEHHLDWCWFSGVSTTELEGVKILTSPLLSEMHSNTQS
RRDLWRQICSYDN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgccccaacaagcactacagtttttaaatgagatggatatttcggtttggcaggttcgt
cagacaagctattttccagcattagaaaacacaacattatcgttacctgaaacttgtcag
ttattatttgtagctcctgctataccgacagaacgtgatgcttttctatttggaaaagtg
cttgcgagtatgaagctgtcgcctgagcaggcgttatttctttcctctgagtcattagaa
tatattggtgagcatcatttagattggtgctggttctctggtgtatcaaccacagagcta
gaaggcgttaaaatattaacctctcctttattgtcagagatgcattctaatactcaatca
cgacgtgatttatggcgacaaatttgttcttatgacaattaa

DBGET integrated database retrieval system