KEGG   Aiivibrio fischeri MJ11: VFMJ11_0507Help
Entry
VFMJ11_0507       CDS       T00754                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00240  Pyrimidine metabolism
vfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VFMJ11_0507 (deoA)
Enzymes [BR:vfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VFMJ11_0507 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Gloverin
Motif
Other DBs
NCBI-ProteinID: ACH65607
UniProt: B5FA99
Position
I:531562..532893
Genome map
AA seq 443 aa AA seqDB search
MYLPQEIIRKKRDNKELTTEEINFFIQGVAKETVSEGQIAAFAMAVYFNEMTMPERIALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIAGYNITPSNDVFGKVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNI
SLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTALLT
DMNQVLASTAGNALEVREAIRFLTGEYRNPRLYEVTMALCAEMLVIANLAKDEQDARAKL
QTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHLESAQIIKPVFADTTGFVHAMDTRDLG
MAVVGMGGGRRVASDTIDYAVGLSDMIRLGQTADNQQPLAMIHARNEEQWQQAANAVKAA
IVISEKQPEATPEVYRKIRPEDV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtatctaccacaagagattattcgtaaaaaacgtgacaataaagagctaacaacagaa
gaaattaacttctttattcaaggcgtagcaaaagaaaccgtttcagaaggtcaaattgca
gcgtttgcaatggcggtatattttaatgaaatgacgatgcctgaacgtatcgcattaaca
tgtgctatgcgtgattctggcatggtcatcgattggagtcacatgaactttgatggccca
attgttgataaacattcaacaggtggtgttggtgatgtaacttcattaatgcttggccct
atggttgccgcatgtggtggttatgtaccaatgatttctggtcgtggtctaggtcataca
ggtggcacgttagataaactagaatctattgcgggttacaatattactccgagtaacgat
gtatttggaaaagtaaccaaagaagcgggtgttgctattattggtcagactggagaccta
gcaccggcggataagcgtgtttatgcgactcgtgatgtaactgcaaccgttgataatatt
tcattaatcacggcatctattttatctaagaaattagcggctggtttagattctcttgtt
atggacgtaaaagtaggttctggcgcatttatgccaacttacgaagcatcagaagagtta
gctaaatcaatcgtagcggtagcaaatggtgctggtactaagacgacagcattgcttact
gatatgaaccaagtactagcttcaactgctggtaacgcattagaagttcgtgaagcaatt
cgtttcttaacaggtgaataccgcaaccctcgtttatatgaagtaacaatggcactttgt
gccgaaatgctagtgattgctaacttagcaaaagatgagcaagacgctcgtgctaaatta
caaacagtattagataacggtaaagctgcagagtgttttggtaaaatggtctttggtctt
ggtggccctagcgacattatcgaaaactacgataatcatttagaaagcgcacaaatcatt
aaacctgtttttgctgatacaacgggctttgttcatgcaatggatacacgtgatttaggc
atggctgttgtaggaatgggtggtggtcgccgtgttgctagcgatacgatcgattatgct
gtagggttaagcgatatgattcgtttaggtcaaactgcggataatcaacaaccacttgca
atgattcatgctcgtaatgaagagcaatggcaacaagctgctaatgcagtaaaagcagcg
attgtgattagtgagaaacaaccagaagcgactcctgaagtttaccgtaaaattcgccct
gaagatgtgtaa

DBGET integrated database retrieval system