KEGG   Vibrio fischeri MJ11: VFMJ11_0507Help
Entry
VFMJ11_0507       CDS       T00754                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vfm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:531562..532893
Genome map
AA seq 443 aa AA seqDB search
MYLPQEIIRKKRDNKELTTEEINFFIQGVAKETVSEGQIAAFAMAVYFNEMTMPERIALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIAGYNITPSNDVFGKVTKEAGVAIIGQTGDLAPADKRVYATRDVTATVDNI
SLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTALLT
DMNQVLASTAGNALEVREAIRFLTGEYRNPRLYEVTMALCAEMLVIANLAKDEQDARAKL
QTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHLESAQIIKPVFADTTGFVHAMDTRDLG
MAVVGMGGGRRVASDTIDYAVGLSDMIRLGQTADNQQPLAMIHARNEEQWQQAANAVKAA
IVISEKQPEATPEVYRKIRPEDV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtatctaccacaagagattattcgtaaaaaacgtgacaataaagagctaacaacagaa
gaaattaacttctttattcaaggcgtagcaaaagaaaccgtttcagaaggtcaaattgca
gcgtttgcaatggcggtatattttaatgaaatgacgatgcctgaacgtatcgcattaaca
tgtgctatgcgtgattctggcatggtcatcgattggagtcacatgaactttgatggccca
attgttgataaacattcaacaggtggtgttggtgatgtaacttcattaatgcttggccct
atggttgccgcatgtggtggttatgtaccaatgatttctggtcgtggtctaggtcataca
ggtggcacgttagataaactagaatctattgcgggttacaatattactccgagtaacgat
gtatttggaaaagtaaccaaagaagcgggtgttgctattattggtcagactggagaccta
gcaccggcggataagcgtgtttatgcgactcgtgatgtaactgcaaccgttgataatatt
tcattaatcacggcatctattttatctaagaaattagcggctggtttagattctcttgtt
atggacgtaaaagtaggttctggcgcatttatgccaacttacgaagcatcagaagagtta
gctaaatcaatcgtagcggtagcaaatggtgctggtactaagacgacagcattgcttact
gatatgaaccaagtactagcttcaactgctggtaacgcattagaagttcgtgaagcaatt
cgtttcttaacaggtgaataccgcaaccctcgtttatatgaagtaacaatggcactttgt
gccgaaatgctagtgattgctaacttagcaaaagatgagcaagacgctcgtgctaaatta
caaacagtattagataacggtaaagctgcagagtgttttggtaaaatggtctttggtctt
ggtggccctagcgacattatcgaaaactacgataatcatttagaaagcgcacaaatcatt
aaacctgtttttgctgatacaacgggctttgttcatgcaatggatacacgtgatttaggc
atggctgttgtaggaatgggtggtggtcgccgtgttgctagcgatacgatcgattatgct
gtagggttaagcgatatgattcgtttaggtcaaactgcggataatcaacaaccacttgca
atgattcatgctcgtaatgaagagcaatggcaacaagctgctaatgcagtaaaagcagcg
attgtgattagtgagaaacaaccagaagcgactcctgaagtttaccgtaaaattcgccct
gaagatgtgtaa

DBGET integrated database retrieval system