KEGG   Vibrio fischeri MJ11: VFMJ11_0597Help
Entry
VFMJ11_0597       CDS       T00754                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vfm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:628845..630863
Genome map
AA seq 672 aa AA seqDB search
MLKQLQHLMDHGVLRPLDLQFAKFIAQQEKNSDSNLLMLLSAITSHELGRGHVCIDIEQI
EQGELFTLPAKYRDALLELVPERSAWAQQLINASTVSNGTEATPLAFDGTRLYLQRYWAF
EQRVSNRITKAAQSVAVNPLLSNTLNELFSRQYHFLFSALKKLENNNQVSRQQLVCDMLD
VVQSDDLDWQAIDTVLLAATKSSELETLDQLIPNNHCVNWQKVAAAVALTRRFSVISGGP
GTGKTTTVTKLLASLVTQAQQDNKNIAIKLVAPTGKAAARLTESIGQAVQSIGLAPEVKE
AIPTDASTLHRLLGYIPNQVDFRHNKSNPLHLDVLVVDEASMVDLPMMARLLDAVPEHAR
VILLGDKDQLASVEAGAVLGDICQFTKMGYSQNQAQQLSQLTGFNLLAQSHNNAVADSLC
MLQKSYRFDARSGIGQLAKAINEGSKFKVEAVWDKGFSDIRFHDLSNDSYNAMITMMVNG
YRSYLGHIHAGDKPEIVLKAFSQIQLLCAMREGDFGVVGLNQRIEKALKKSDLIPHGDEI
WYSGRPVMVTQNDYGVGLYNGDIGIAMPDPIDQRLRVYFDMPDGSIRGVLPSQLPEHETV
YAMTIHKSQGSEFEHTVLALPAEFSPILTRELIYTGVTRAKKKLDLFATEKVVARGVMIK
TQRNSGLVSLMS
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcaattacaacacttaatggatcatggcgtgctacgccctttggatcttcaa
tttgccaagtttatcgctcagcaagaaaaaaacagtgatagtaatttacttatgctgcta
tcagccattacgagtcatgagctaggtcgtggtcatgtatgtattgatattgagcagata
gagcaaggggagctctttactcttcccgcaaaatatcgtgatgcgttattagagttagtc
ccagaaagaagcgcttgggcacaacaattaattaatgcatcaaccgtctcaaatggcaca
gaggcaactcctttagcttttgatggtactcgcttgtatttacaacgctactgggcattt
gagcaacgtgtgtctaaccgtattactaaagctgctcaaagtgttgcagtaaaccctctg
ctatcgaatacattgaatgagttgttttctcgtcagtatcattttttattttcagcattg
aaaaagttggagaataacaatcaagtttctcgccaacaattagtgtgcgatatgcttgat
gttgttcaatcagatgatcttgattggcaggcgattgatacggttttattagccgcgacc
aaatcttcagaattagaaacgttagaccaattaattccaaataaccactgtgttaattgg
caaaaagtcgcggcagctgtggcgttaactcgtcgattctccgtaatttctggtggtcca
ggtacgggtaaaacaaccacagtaaccaagcttttggcttccttagtgacacaagctcag
caggataataaaaacatagcgattaaactggttgcgccaactggtaaagccgcggcgcgt
ttgactgaatctattggtcaggcagtacaatccattggtttagcacctgaagtgaaagaa
gcgatcccaacggatgccagtacgctacatcgcttacttggttatattcccaatcaagtg
gattttcgccataacaaatccaatccgttacaccttgatgtattggtggtggatgaagcg
tctatggtcgatttgcctatgatggctcgattactcgatgcggtacctgaacacgctcgt
gttattttattgggcgataaagatcaactcgcttcggttgaagcgggagcggtgttaggt
gatatttgtcagtttactaaaatgggttatagccagaaccaagctcagcaattatctcaa
ctaactggctttaatctactggctcaatcacataataatgcggttgcagatagcttatgt
atgctgcaaaagagttaccgttttgatgcgcgttcaggcataggccagcttgccaaagcc
attaatgaaggcagtaaatttaaagtagaagccgtgtgggataaagggttttcagatatt
cgttttcatgatttaagtaatgatagctataacgcaatgattactatgatggtcaatggt
tatcgcagttacttaggtcatattcacgcaggcgataaacctgaaatcgtactgaaagca
tttagccaaattcaattattatgtgcgatgcgtgaaggggattttggtgtagttggatta
aatcaacgtattgaaaaagcgttgaaaaagtctgatttaatccctcatggtgatgaaatt
tggtattcaggtcgccctgttatggtgacgcaaaatgattatggtgtgggtttgtataat
ggtgatattggtattgctatgccagatcctattgatcagcgtttgcgtgtctattttgat
atgccagatggctctattcgtggtgtgctaccaagtcaattaccagagcatgaaacggtt
tatgcaatgacaattcataagtctcagggctctgagtttgagcatacagtattggcattg
cctgcagagtttagcccaattttaacccgtgagctgatttatacgggggtcactcgagcg
aagaaaaaactcgatttatttgcgacagaaaaagtggtggctagaggggttatgattaaa
actcagagaaacagtgggttagtatcactaatgagttaa

DBGET integrated database retrieval system