KEGG   Aiivibrio fischeri MJ11: VFMJ11_0619Help
Entry
VFMJ11_0619       CDS       T00754                                 

Definition
beta-glucosidase A (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VFMJ11_0619
Enzymes [BR:vfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VFMJ11_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:653044..654453
Genome map
AA seq 469 aa AA seqDB search
MKFAHDFLFGAATASYQVEGAWDQDGKGPTNWDEFTKIPGKTFEGTNGDVAVDHYNRYKE
DIALMAEMGLESYRFSISWARIFPNGTGEINQKGIDFYNNLIDECLKYGIVPFVTLYHWD
LPLALEKEGAWLNKATGDAYVEFAKLCFNEFGDRVKHFITFNETVVFCALGYMAGAHPPG
IQNDPKKYFQATHNVFYAHAKAVIEYKKLNQFGEIGLSHVFSPAFGVDDSEESHFAAMHA
NQFSMNWFYDPILLGKYPEYVVKQLQEEGNLPDWTDEELQTIFEAAPLNDFMGLNYYQPQ
RVEKIQGDVEARTITRENSTGSPGNPSYDNVYRTVKMADKKYTKWDWEISPEGFVGGLEM
LKEHYGQIKLYITENGLGDEDPIIDGEVCDIPRINFIKEHLGAVKEAVRRGVHIKGYYAW
SAIDLLSWLNGYKKQYGFIYVDHQNGLARKKKASFHWFKDVIATRGEDI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcacatgattttttatttggcgcagcaaccgcttcttatcaagtggaaggc
gcgtgggatcaagatggtaaaggtcctacaaactgggatgagtttactaaaataccagga
aaaacatttgaaggaacgaacggtgatgtcgcggttgatcattacaatcgttataaagaa
gacatcgctttaatggcggaaatgggattagagtcataccgtttttcaatttcttgggct
cgtattttcccaaatggaacgggtgaaattaaccaaaaaggcatcgatttttataataat
ctgatcgatgaatgtttgaaatatggcattgttccttttgttactctatatcactgggat
ctgccattagcactagaaaaagaaggtgcatggttaaataaagcgacgggcgatgcgtat
gtcgagttcgctaaattatgtttcaacgaattcggtgaccgtgttaagcattttataacg
tttaatgaaacggttgtgttctgtgctctaggatatatggcaggcgcacacccaccaggc
attcaaaatgacccgaaaaaatacttccaagcaacacataacgtattttacgctcatgct
aaagcggtgattgaatataaaaaattaaatcaatttggtgagattggtttgagtcatgta
tttagccctgcatttggggttgatgattctgaagagagtcactttgctgcaatgcatgcg
aaccaatttagtatgaattggttctatgatcctattttgcttggtaaatacccagagtat
gtagttaagcaattacaagaagaaggtaaccttcctgattggacggatgaagagctacaa
actatttttgaagccgcacctttgaatgactttatgggattgaattattaccagcctcag
cgtgtagagaaaattcaaggagatgttgaagctcgtacgattacacgagaaaactcaacg
ggctcacctggtaaccctagttacgataatgtgtatcgtactgtgaaaatggcagataaa
aagtacacgaaatgggattgggaaatttcacctgaagggtttgttggcggattagaaatg
ctgaaagagcactatggtcaaattaaactctacatcacggaaaatggtttaggtgatgaa
gatccaattattgatggtgaggtgtgcgatattccacgtattaattttattaaagagcac
ttaggtgcggtaaaagaagcggttcgtcgtggtgttcatattaaagggtattacgcttgg
tctgccattgacttattaagttggttaaatggttataaaaagcaatatggttttatttat
gttgatcatcaaaatggattagctcgtaagaaaaaagcatcattccattggtttaaagat
gtcattgccactcgtggtgaagatatttaa

DBGET integrated database retrieval system