KEGG   Vibrio fischeri MJ11: VFMJ11_0759Help
Entry
VFMJ11_0759       CDS       T00754                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vfm  Vibrio fischeri MJ11
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vfm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vfm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:796677..797702
Genome map
AA seq 341 aa AA seqDB search
MVELVRQCVQLKKAGHQVIVVTSGAIAAGREHLNYPELPKTMANKQLLAAVGQSCLIQAW
QSLFGIYGVDVGQMLLTRADLDDRERYLNARDMLQALLKNNIVPIVNENDAVATNEIKVG
DNDNLSALVGILAGADKLLLLTDQSGLFTADPRKDPKAELIKEVHTIDETLRKIAGGSGT
TLGTGGMATKLQAADVARRAGIEVIIAAGSAENVITDVVNSKPQGTKFLPVECALESRKR
WILAGPPSKGSIVIDEGAVNAVQQKGSSLLSKGITEVSGHFVRGGVAKIVNTKGELIARG
ISRYSSDDLSKILGKHSQDIYAVLGYEYGPVAIHRDDLVLI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattagttcgccaatgtgttcagctaaaaaaagctggccatcaagttattgtt
gttacgtctggcgcaattgctgctggccgtgagcatcttaactaccccgaactacccaaa
accatggctaacaagcagttattagctgctgttggtcaaagttgcttaattcaagcatgg
caaagtttgtttggtatttatggtgtcgacgtaggtcaaatgctattaactcgagctgat
ttggatgatcgtgagcgttatttaaatgcacgagatatgcttcaggcgctattaaaaaat
aatatcgttcctatcgttaatgaaaatgatgcggtagcaaccaatgaaattaaagttggt
gataacgataacctttctgcattagtcggtattttagcgggtgcagataaattattattg
ttaacagaccaatcgggtctatttaccgctgatccacgtaaagatccaaaagcagaattg
atcaaagaagttcatactatcgatgaaacactacgcaagatagctggcggaagtggtaca
actcttggtaccggtggtatggcgacgaagctgcaagctgctgatgtggcgcgccgagcg
ggtattgaagtaattattgctgctggtagtgctgaaaatgtaattactgatgtggttaac
tctaaacctcaaggtacgaagttcttacctgttgagtgtgctttagagagccgtaaacgt
tggatcttagctgggcctccatcaaaaggtagcattgttattgatgaaggcgcagttaat
gcagttcaacaaaaaggcagcagtttattaagtaaaggtatcactgaggtatctggccat
ttcgttcgtggtggcgtagccaaaattgtgaatacaaaaggtgaattgatcgctcgtggt
atttcacgttattcaagtgatgacttatctaagattttaggaaaacacagtcaggatatt
tacgcagtattaggctacgaatatggccctgtagctatccatcgtgatgatttagtactg
atttag

DBGET integrated database retrieval system