KEGG   Aiivibrio fischeri MJ11: VFMJ11_0863Help
Entry
VFMJ11_0863       CDS       T00754                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vfm  Aiivibrio fischeri MJ11
Pathway
vfm00020  Citrate cycle (TCA cycle)
vfm00640  Propanoate metabolism
vfm00660  C5-Branched dibasic acid metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm01130  Biosynthesis of antibiotics
vfm01200  Carbon metabolism
Module
vfm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vfm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vfm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VFMJ11_0863
   00640 Propanoate metabolism
    VFMJ11_0863
   00660 C5-Branched dibasic acid metabolism
    VFMJ11_0863
Enzymes [BR:vfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VFMJ11_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACH65631
UniProt: B5FC28
Position
I:895891..897057
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTFQTDANGQPVSKILVEEASNIANELYLGAVVDRASQR
IVFMASTEGGVDIEKIAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLEGDQIKQFVKI
FMGLGNMFAQYDLALLEINPLVVTAEGSLLCLDGKINIDSNAMYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGSIGCMVNGAGLAMGTMDIVNLHGGQPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVEVPVVVRLEGNNAPLGSQK
LAESGLNIIAATSLTEAAEKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaagcaaagcagctctttgcagaatttggccttcctgtaccc
gagggttatgcttgcgatacacctcaagaagcttttgaagctgcaggccgtattagtacg
gcgaaaaaagtagttaagtgtcaagtacacgctggtggccgtggtaaagcgggcggtgtt
gaactgcatgacacaaaagaaggtgttaaagaatttgcacaaaaatggctaggtaaaaat
ctagttactttccaaactgatgccaacggccaacctgtatcaaaaattttagttgaagaa
gcatcaaatattgcgaatgaattgtacttaggtgcagttgtcgatcgtgcatcacagcgt
attgtatttatggcatcgactgaaggtggcgttgatattgaaaaaattgctgaagaaaca
ccagaactgatacataaagcggcgatcgatcctcttgttggtcctcaagcataccaaggt
cgtgaattggcattcaaattgggtttagaaggcgatcaaattaagcaatttgttaaaatc
ttcatgggcctaggtaacatgtttgctcagtacgatttagcacttcttgaaatcaaccca
ttagtggttactgctgaaggtagccttctatgtcttgacggcaaaatcaacattgattca
aatgcgatgtaccgtcaacctaagcttcgtgaaatgcacgatccttctcaagaagacgag
cgtgaagcgcatgctgctcagtgggaattaaactacgtagcacttgatggcagtattggc
tgtatggttaatggtgcgggtcttgcgatgggtacgatggatatcgtaaatctacacggt
ggccaaccagctaacttccttgatgtaggtggtggtgcaacaaaagagcgtgtaactgaa
gcgttcaaaattattttatcagacagtaatgttaaagcggttctcgtaaacatctttggt
ggtattgttcgttgtgacctaattgcagatggcatcattggtgctgttgaagaagtgggt
gttgaagttcctgttgttgttcgccttgaaggtaacaatgcaccactaggttcacaaaaa
ctggctgaaagtggcctaaatatcattgcggctacttcattaactgaagcggctgaaaaa
gttgttgctgcagcggagggcaaataa

DBGET integrated database retrieval system